KEGG   Meiothermus ruber DSM 1279: Mrub_0451Help
Entry
Mrub_0451         CDS       T01193                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00130  Ubiquinone and other terpenoid-quinone biosynthesis
mrb00627  Aminobenzoate degradation
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01120  Microbial metabolism in diverse environments
mrb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Mrub_0451
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Mrub_0451
Enzymes [BR:mrb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Mrub_0451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ADD27228
UniProt: D3PMQ3
Position
438130..438720
Genome map
AA seq 196 aa AA seqDB search
MSVPKRLVVGLSGASGMPYALDLLQTLRRVGGLEVHLVMSQGAKRVLAEEAGLSLEAVEA
LAHVVHRSSDLGAPIASGSFRTLGMVIVPCSATTLAKVAYGLADNLLTRAAYVTLKERRP
LVLVPREAPLPLPSLEAMVKATLAGATILPAAPGFYHKPQTIEDLLAFMTQRILDLLGLE
YSRAPRWGELQELELD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtacccaagcgactggtggtggggctttcgggcgcttcggggatgccctacgcc
ctggatctgctgcaaaccctgcgacgggtgggggggttggaagtccacctggtgatgagc
cagggggccaagcgggtgctggcggaggaggcggggctgagcctcgaggctgtggaggcc
ctggcccatgtggtgcaccgcagcagcgacctgggggcccccattgcctcggggagcttt
cgtaccctgggtatggtgattgtgccgtgcagtgcgaccaccctggctaaggtggcctac
ggtctggccgacaacctcctgacccgggcggcctatgtgaccctcaaggagcgccgcccc
ctggtgctggtgccgcgcgaggccccgctgcctttgccgagcctcgaggccatggtcaaa
gccaccctggccggggccaccatactgccggctgcccccggcttctaccacaagccccaa
accatcgaggatctgctggcttttatgacccagcgcattttggatctgttggggcttgag
tactccagggcgccgcgctggggcgagttacaggagctcgagctcgactag

DBGET integrated database retrieval system