KEGG   Meiothermus ruber DSM 1279: Mrub_0454Help
Entry
Mrub_0454         CDS       T01193                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritolkinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00900  Terpenoid backbone biosynthesis
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01130  Biosynthesis of antibiotics
Module
mrb_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mrub_0454
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Mrub_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADD27231
UniProt: D3PMQ6
Position
440189..441016
Genome map
AA seq 275 aa AA seqDB search
MELLAPAKVNLGLSVLGRRPDGYHELHTLFAALRVGDRLWVEAIPEGIELEVWGRGLPAD
TNNLVYKAAQAYLTAAGWPGGVRVVLEKNLPLAAGLGGGSSDAAAVLRALSQLYPSALEL
PGLALGLGADVPFFLGPGLAEGRGVGERLTPLPPIRAALVLVNPGIAVSAAEAYKGLTPE
MWQPELDVAGVVEAIQVGEEPPYWNTLERSVFRLHPYLEALKQELYRLGLRGVLMSGSGS
TLFGLARDGAEAGYLAGVLRDKHPGFWVVATETVS
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaactgctagccccggccaaggtgaacctgggtctttcggtgctgggccgccgcccc
gacggctaccacgaattgcacaccctgtttgcagccctgcgggtgggcgaccgcctctgg
gtggaggccattcccgagggaattgagctggaggtgtggggcaggggcctgcccgctgat
accaacaacctggtatacaaggcggcgcaggcttacctgacggctgctggctggcccggt
ggggtgcgggtggtactggaaaagaacctgcccctggccgcggggctgggtgggggttcc
tccgatgcggcggcggtgctgcgggctttatcccagctctatccatccgccctcgagctg
ccggggctggcccttgggctgggggccgacgtgccctttttcctggggccgggcctggcc
gaagggcggggggtgggtgaacgactgacccccctgccgcccatccgggctgcgctggtg
ctggtgaacccgggcattgcggtttcggcggctgaggcctacaagggccttacacccgag
atgtggcagcccgaactggatgtggcgggggtggtggaagccatacaggtgggggaggag
cccccttactggaatacgctcgagcgctccgtatttcgcctgcacccctacctcgaggcc
ctcaaacaagagctgtaccgcctggggctcaggggcgtgctgatgtcgggctcgggttct
accctgtttgggctggcccgtgatggggccgaggccgggtatctggctggggtgctgcgg
gataagcaccctgggttctgggtggtcgctaccgagaccgtaagctaa

DBGET integrated database retrieval system