KEGG   Meiothermus ruber DSM 1279: Mrub_0456Help
Entry
Mrub_0456         CDS       T01193                                 

Definition
(GenBank) binding-protein-dependent transport systems inner membrane component
  KO
K02063  thiamine transport system permease protein
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mrub_0456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mrb02000]
    Mrub_0456
Transporters [BR:mrb02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Thiamine transporter [MD:M00191] [OT]
    Mrub_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADD27233
UniProt: D3PMQ8
Position
442269..443798
Genome map
AA seq 509 aa AA seqDB search
MAKASRAASWLALPVLVFLALALLYPLGRIVALGLTEGFIATLGDPYYRSRLLWSLAYGL
GSSLLCIGMALPLAYAFRYRFPGRDFWLAFSVVPFVLPTLVVAMGFLSLVGPRGLLGINL
YDTPWILFWASLLYNLGLVLRPLVALLPMLSTPLQAARTLGASPIRAYLRVGIPLLTPAL
LSGGSLVFLFSFTSFGVPLLLGGPGWATLEVATYQALAQRLAFPEASALVLMQLVVTGLV
LWLYLRLQTGWVVGLEGAEAPLPLMRGRALALAIGVAGVFLLLYSPLLALVWRALERPGA
WLSVWRNPDFTPGLLALQNTLAFAGVALLGVLPVGFLYAYAVWRGARWLDGLGLLPLMVS
PVALGLGYLLVYPGLRGSIWLLIGAYILLSYPLLTRTLLPALQGLPQGVLEAARVLGASP
WRRFIGVEWPLVRPSTTAGLALALAAILGEFGATLTLQRPEWATLSLAIYERLGRPGATP
FYEAVVLAVALMALCTVLLLGLQKGTWER
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggcctcccgcgccgcctcctggctggccctgccggtgctggtgttcctggcc
ctggcgctgctgtaccctttggggcgcattgtggccctgggcctgaccgaggggtttatc
gccacgctgggagatccctactaccgctcgaggctgctctggagcctggcctatggcctg
ggttcctccttgctttgtattgggatggccctgcccctggcctacgcttttcgctaccgc
ttcccgggccgggacttctggctggccttctcagtggtgccctttgtgctgcccaccctg
gtggtggccatgggttttttaagtctggtgggcccccggggtctgctgggcatcaacctg
tacgacaccccctggattctgttctgggccagcctgctctataacctgggcctggttttg
cgccccttggtggccctgctgcccatgctgagcacccccctgcaggcagcccgcaccctg
ggggccagccccatacgggcctacctgcgggtggggataccccttttgaccccggccctg
ctgtccggcggaagcctggtgttcttgtttagctttaccagttttggtgtgcccctgctg
ctgggagggccggggtgggccacgctcgaggtagccacctatcaggccctggcccagcgc
ctggccttcccggaagccagcgcactggtactgatgcagctcgtggtgaccggcctggtg
ctgtggttgtacctgcgcttgcagacggggtgggtggtggggctcgagggcgccgaagcc
cctctacccctcatgaggggccgcgctttggctctggccatcggtgtggctggggttttt
ttgctgctgtatagtcccttgctggcgctggtatggcgggcactggagcgtcctggggcc
tggctatcggtgtggcgcaaccccgactttaccccaggcctgctggccttgcaaaacacc
ctggcctttgccggggtggccctgctgggggtgctgcccgtgggttttttgtacgcctat
gcagtctggcggggggcccgctggctggatgggctgggcctgctgcccctgatggtctca
ccggtggccctgggcctgggctacctgctggtctaccccgggcttaggggctccatctgg
cttttgataggggcctacatcctgctcagctaccccttgctcacccgcaccctgttgccg
gccctgcaggggctgccccagggggtgctcgaggccgcccgggtgttgggggcctcaccc
tggcggcggtttataggggtggaatggcccctggttcgcccctcgaccaccgccggcctg
gccctggccctggcggccatcctgggggagtttggggccaccctcaccctgcaacgcccg
gaatgggccaccctgtccctggccatctacgagcgcctgggccggcctggggccaccccc
ttttacgaggcggtggtgctggcggtggcgctgatggcgctgtgcacggttttgctcctg
gggttgcagaagggcacctgggagcgctga

DBGET integrated database retrieval system