KEGG   Meiothermus ruber DSM 1279: Mrub_0461Help
Entry
Mrub_0461         CDS       T01193                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_4
Motif
Other DBs
NCBI-ProteinID: ADD27238
Position
complement(447550..448695)
Genome map
AA seq 381 aa AA seqDB search
MSTAAPNQLAPARKAIYVTFFICGLVLAAWVSRIPAIKQQLGLNAGELGLVLMGGPIGLV
LAMPLTGWLIARWGSRPVLAWAAMSNCAALPLLALAPNGWALGLALFVFGFANAAMDIAM
NAQAVEVEKRYTRPIMSSFHALFSLGGLVGAALGGAAAAGGLAPLPFFAWTALVTGLLML
AATRYLLEVRPAASGPRFVWPRGVLLGLGLIVFCTGLGEGAVADWSAVFMKHEMGTSEAV
AALAFSAFSVAMVVGRLSGDALIHRFGPVAMARAGGLLAASGFITTLVTNRPEVAMLGFV
LIGLGYCTLFPLVFSAAGRVPGVQPGVALASVATLGYLGFLSGPPLIGLVAQVTSLRVSF
MAVAGLAVLISLLAGLLQVKK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaccgcagcccccaatcaactcgctccggctcggaaggccatctatgtaactttt
tttatatgcggtctggtgctggccgcctgggtttcacgcattccggccatcaagcagcag
ctaggcctgaacgccggcgagctgggcctggtgctgatgggaggccccatcggactggtg
ctggccatgcccctaaccggctggctgatcgcgcgctggggcagccgaccggtgctggcc
tgggccgccatgagcaactgcgccgcgctacccctgctggccctggcccccaacggctgg
gcgctgggcctggctctgtttgtatttggcttcgccaacgcggccatggacatcgccatg
aacgcccaggccgtggaggttgaaaaacgctacacccggcccattatgtccagtttccat
gcgctgtttagcctggggggcctggtaggggccgccctgggaggggccgccgcagcgggc
ggactggcaccgctgcccttctttgcctggacggccctggtcacggggctgctgatgctg
gcggccactcgatacctgctcgaggttcgaccagccgcgagcgggccgcgctttgtctgg
cctcgaggggtgctgctgggcctgggcttgatcgtgttctgcaccggcctgggcgagggg
gctgtggccgactggagcgcggtattcatgaagcacgagatgggcaccagcgaggccgtg
gccgcgctggccttctcggcgttttcggtggccatggtggtgggccgcctgagcggcgac
gccctcatacatcggtttgggccggtggcgatggctcgagccggtggcctgctggccgcc
agcggtttcataaccacgcttgttaccaaccgccccgaggtcgccatgctgggctttgtg
ctgatcgggctgggttactgcaccttgtttcccctggtgttcagcgccgccggcagggtg
ccgggggtgcagcccggggtggcgctggcttcggtggcaacgctgggctacctggggttt
ttgagcgggccgcccctgatcggcctggtggcccaggtgacctcgctgcgggtatctttt
atggcggtagcggggctggccgtgctgatttctctgctcgccgggctcctgcaagttaaa
aaatga

DBGET integrated database retrieval system