KEGG   Meiothermus ruber DSM 1279: Mrub_0969Help
Entry
Mrub_0969         CDS       T01193                                 

Definition
(GenBank) ribonucleoside-diphosphate reductase, alpha subunit
  KO
K00525  ribonucleoside-diphosphate reductase alpha chain [EC:1.17.4.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00230  Purine metabolism
mrb00240  Pyrimidine metabolism
mrb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mrub_0969
   00240 Pyrimidine metabolism
    Mrub_0969
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     Mrub_0969
DNA repair and recombination proteins [BR:mrb03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    Mrub_0969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_lgC RNR_N Ribonuc_red_lgN adh_short
Motif
Other DBs
NCBI-ProteinID: ADD27734
UniProt: D3PQK1
Position
complement(959180..961255)
Genome map
AA seq 691 aa AA seqDB search
MRYLELNSALLHKKNGFFQLEKDLEAAQAFEEEVLLRLRRFSDPLERFQALIQEGYYEDF
FARYEAADLLRLYRLAESYPFRFQSFMAVSKFYKDYALKSDDKKLYLERYFERVLAVALH
LGQGDVQKAEAYVRAMMEQRYQPATPTFLNAGRARRGELVSCFLLELDDSLNSIGYNLNA
AMQLSKIGGGVALNLSKLRARGEPIKGVAHAAKGVVPVAKLLEDAFNYADQMGQRKGAGA
VYLNIFHWDVEEFLDTKKINADEKSRLQTLSLGLLVPQKFFDLAEAGEDFYVFAPYSVYR
AFGEHLDDMDLDRMYEALVAHPEVKKRPLSARQMLTRIAQTQFESGYPYIVYRSNANRQH
PLKALGQIKMSNLCTEIFQLQTPTLVGDAGEVVEAGFDISCNLGSLNIVNVMEQQNLAES
VHTAMDALTAVSDASAVRQVPGVWRANQAFHSVGLGVMNLHGFLAKNQIRYESEEARDFV
RSFFAAMNYYSLERSMEIARERGQTFHGFEQSEYASGRYFEKYQEDFRPRTETVRKLFEG
IPLPSPADWARLKEAVEQHGLYHAYRLAVAPTASISYIQNATPSIQPIVEHVETRTYGNA
TTYYPMPFLSEETYWFYKSAYHMNMYRVIDLVAEAQQHVDQGISTVLFVTSETSTRELAR
LYVYAAKKGLKSLYYTRTKNLSVEECLTCAV
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctggaactgaacagtgcgctgttgcataagaaaaacggctttttccagctc
gagaaagacctcgaggcagcccaggccttcgaggaggaggtgctgctgcggctgcggcgg
ttctcagatccgctggagcgcttccaggcgctgatccaggagggctactacgaggatttc
ttcgctcggtatgaggcggccgacctgttgcggctttaccgcctggccgaaagctacccc
ttccgcttccagagcttcatggcggtctccaagttctacaaggactacgccctcaaaagc
gacgacaagaagctctacctggagcgctactttgagcgggtactggcggtggcgctgcac
ctggggcagggggatgtgcaaaaggccgaggcctatgtccgggccatgatggagcagcgc
taccagcccgccacccccaccttcctgaacgcggggcgggcccggcggggcgagctggtc
tcctgctttctgctggagctcgacgactccctcaactccatcggctacaacctgaacgcg
gccatgcagctctccaagatcgggggcggggtggccctcaacctctccaagctgcgggcg
cgcggggagcccatcaagggggtggcccacgccgccaagggggtggtgccggtggccaag
ctgctggaggacgctttcaactacgccgaccagatgggccagcgcaagggggccggggcg
gtctacctgaacatcttccactgggacgtggaggagttcctcgacaccaagaagatcaac
gccgacgagaaaagccgcctgcaaaccctctcgctgggcctcttggtgccgcaaaagttc
ttcgacttggccgaggccggggaggatttttacgtcttcgcgccctactcggtctaccgg
gctttcggcgaacacctcgacgatatggacctcgaccggatgtacgaggccctggtcgcc
caccccgaggtcaagaaacggcccctctcggcccgccagatgctcacccggatcgcccag
acccagttcgagtcgggctacccctatatcgtctaccgcagcaacgccaaccgccagcac
cccctgaaagccctgggccagatcaagatgtccaacctctgcaccgagatcttccagctc
cagacccccaccctggtgggggacgccggggaggtggtggaggcgggcttcgatattagc
tgcaacctgggcagcctgaacatcgtgaacgtgatggagcagcagaacctggccgagagc
gtgcacaccgcgatggacgcccttaccgcggtcagcgacgccagcgcggtgcggcaggtg
cccggggtctggcgggccaaccaggccttccactcggtgggcctgggggtgatgaacctg
cacggcttcttggccaaaaatcagatccgctacgagtccgaagaggcccgcgacttcgtg
cgcagcttcttcgcggcgatgaactactacagcctggagcgctccatggagatcgcccgc
gagcgggggcagaccttccacggcttcgaacaaagcgagtacgccagcgggcggtacttc
gagaagtaccaggaggacttccggccccggacggagacggtgcggaagctcttcgagggc
atccccctgcccagccccgcggactgggcccgcctgaaggaagcggtagagcagcacggc
ctctaccacgcctaccggctggcggtggcccccaccgcctccattagctacatccagaac
gccaccccttccatccagcccatcgtggagcacgtggagacccgcacctacggcaacgcc
accacctactaccccatgcccttcctctcggaggagacctactggttctacaagtcggcg
taccacatgaacatgtaccgggtgatcgacctggtggccgaggcccagcagcacgtggac
cagggcatcagcaccgtcctattcgtgaccagcgagaccagcacccgcgagctggcccgg
ctgtatgtgtacgccgccaagaaaggtttgaagagcctgtactacacccgcaccaagaac
ctcagcgtggaagaatgcctgacctgtgcggtttga

DBGET integrated database retrieval system