KEGG   Meiothermus ruber DSM 1279: Mrub_0970Help
Entry
Mrub_0970         CDS       T01193                                 

Definition
(GenBank) NrdI protein
  KO
K03647  protein involved in ribonucleotide reduction
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99984 Nucleotide metabolism
    Mrub_0970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavodoxin_NdrI
Motif
Other DBs
NCBI-ProteinID: ADD27735
UniProt: D3PQK2
Position
complement(961218..961598)
Genome map
AA seq 126 aa AA seqDB search
MLVVYTSKTGNVARFVARLGLPALRLGDGTEKIAEPCLLITYTTGFGQVPPEVLRFVENN
RHLIVGVAASGNRNWGANFARAADLLAERYGIRVIHKFELSGTARDIEIIKEAIHALSGT
EQCAVA
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
ttgctagtcgtctacacctccaagaccggcaacgtcgcccgctttgtcgcccggctgggc
ctgccggccctgcgccttggcgacggcacggaaaaaatcgccgaaccctgcctgctcatc
acctacaccaccggcttcggccaggttcccccggaggtgctgaggttcgttgaaaacaac
cgccacctgatcgtgggggtggcggccagcggcaaccgcaactggggggctaactttgcc
cgggccgccgacctgctggccgaacgctacgggattcgcgtgatccacaagtttgaacta
tccggtactgcaagggatatagagatcatcaaggaggccatccatgcgctatctggaact
gaacagtgcgctgttgcataa

DBGET integrated database retrieval system