KEGG   Meiothermus ruber DSM 1279: Mrub_0971Help
Entry
Mrub_0971         CDS       T01193                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DrsE
Motif
Other DBs
NCBI-ProteinID: ADD27736
UniProt: D3PQK3
Position
962001..962390
Genome map
AA seq 129 aa AA seqDB search
MKVAYVFAHPRAASYKLGQMILPQLEAGTHGVEVVGMFFFDDNVYILRQGDAVGERLARL
AEAEGILLMMCDMCALERGLATGQPRWCEGRTSPAACNPQGTVPGVQVGCFPDLYAALAS
NPPDQIITL
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggcgtatgtgtttgctcatcctcgagccgccagctacaagctgggccagatg
atattgccccagctcgaggctggcacgcacggggtggaggtggtggggatgttcttcttc
gacgacaacgtgtacatcctgcgccagggggatgccgtgggtgagcggctggcccggctg
gctgaagcggagggcattttgctgatgatgtgcgatatgtgcgcgctcgagcggggcctg
gctacagggcagccccgctggtgcgagggccgtaccagtccggctgcctgcaatccacag
ggaaccgtaccgggggtgcaggtgggctgcttccccgatctgtacgccgccctggcctcc
aacccgccggatcagatcatcacgctttga

DBGET integrated database retrieval system