KEGG   Meiothermus ruber DSM 1279: Mrub_0976Help
Entry
Mrub_0976         CDS       T01193                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00260  Glycine, serine and threonine metabolism
mrb00261  Monobactam biosynthesis
mrb00270  Cysteine and methionine metabolism
mrb00300  Lysine biosynthesis
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01120  Microbial metabolism in diverse environments
mrb01130  Biosynthesis of antibiotics
mrb01210  2-Oxocarboxylic acid metabolism
mrb01230  Biosynthesis of amino acids
Module
mrb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mrub_0976
   00270 Cysteine and methionine metabolism
    Mrub_0976
   00300 Lysine biosynthesis
    Mrub_0976
  Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    Mrub_0976
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     Mrub_0976
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT ACT_7 ACT_6 Alba
Motif
Other DBs
NCBI-ProteinID: ADD27741
UniProt: D3PQK8
Position
964404..965630
Genome map
AA seq 408 aa AA seqDB search
MALIVQKYGGTSVGDLERIHKVAQRIHHYLEKGHRIAVVVSAMGRTTDELIALARRVNKR
PPQRELDMLTTIGEQQSVALLSMQLHAMGIPARGFTQHQIGITTDGRYGDARILRVEPTL
IQQALDRGEVAVVAGFMGTTPEGELTTLGRGGSDTTAVALAAALGAQECEIFTDTEGVYT
TDPHAIPEAQKLSRIGYDQMLEMAALGARVLHPRSVYYGKRYGVKIHVRSSFSYNPGTIV
TEDGMELDRPVTGVALDDEIAQIGLVGIPDRPGIAARVFEALARKGVAVDMIIQGVPGHE
ASRTQMAFTVNQDFAEEAMEALEPVLAEIGGEAQLRRDICKISIVGVALASTPGIPARMF
QALSSVGANIDMIATSEVRISAIIPLQFAEAALRAVHSAFELDKPVEK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcccttatcgtgcaaaaatacggcggaaccagcgtgggcgacctcgagcgcatccac
aaggtggcccagcgcatccaccactacctcgagaagggacaccggattgccgtggtggtc
tcggccatgggccgcaccaccgacgagctgatcgccctggccaggcgggtcaacaaacgc
ccgcctcagcgcgagctcgacatgctcaccaccatcggcgagcagcagtcggtggccctg
ctttcaatgcagctccacgccatgggcatccccgcgcggggttttacccagcaccagatt
ggcatcaccaccgacggacgctacggcgacgcccgcatcctgcgggtggagcccaccctc
atccagcaggccctggataggggggaggtggcggtggtggcgggttttatgggcaccacc
ccggaaggcgagctgaccaccttgggtcggggcggttccgataccaccgccgtagccctg
gccgcggccctgggagcccaggagtgcgagatttttaccgacaccgaaggggtctacacc
accgacccccacgccattcccgaggcccagaagctgagccgcatcggctacgatcagatg
ctggagatggccgccctgggggcgcgggtgctgcacccccggtcggtctactacggcaag
cgctatggggtgaaaatccacgtgcgcagcagcttttcctacaaccctggcaccattgtt
acggaggatggaatggaactcgatcgcccagtgacgggggtagccctcgacgatgaaatt
gcccagattggcctggttggcatccccgaccggcccggtatcgccgcgcgggtctttgag
gccctggcccgcaagggggtggcggtggacatgattatccagggcgtgcccggccacgag
gccagccgcacccagatggccttcacggtcaaccaggacttcgccgaggaggccatggag
gccctcgagccggttctggccgagattggcggcgaggcccagctaaggcgggacatctgc
aaaatctccatcgtgggcgtggccctggcctcgacccccggcattccggcccgcatgttc
caggccctctcgagcgtgggggccaacatcgacatgatcgccaccagcgaggtgcgcatc
tccgccatcatccccctacagttcgccgaggccgccctgcgcgcggtgcacagcgccttc
gagctggataagccggtggaaaagtaa

DBGET integrated database retrieval system