KEGG   Meiothermus ruber DSM 1279: Mrub_0981Help
Entry
Mrub_0981         CDS       T01193                                 

Definition
(GenBank) integral membrane protein MviN
  KO
K03980  putative peptidoglycan lipid II flippase
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mrb01011]
    Mrub_0981
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mrb02000]
    Mrub_0981
Peptidoglycan biosynthesis and degradation proteins [BR:mrb01011]
 Precursor biosynthesis
  Flippase
   Mrub_0981
Transporters [BR:mrb02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Mrub_0981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MVIN
Motif
Other DBs
NCBI-ProteinID: ADD27746
UniProt: D3PQL3
Position
complement(970078..971580)
Genome map
AA seq 500 aa AA seqDB search
MSRILRNTLLVMAGTLASRLLGQVRQTILTNLPLPDTTKDAFWVAYRIPNLLRELLAEGA
IQNALIPVLTGLPPEEARTFARRFGAFLLGVNLVILGLGLLFAPQIAGALLWLAELSLAQ
PSPLRDPAVFEQLVLLIRLVMPFLLSISMASLFSSMLQSGERFGLTSFSPVAFNLGSIAL
MLLFPSSIAALGLSVTLGGALQALVQLPALKGYGLEFRWHPAFRAALGRIGPFAFTTSVR
QFLNLVLLSILAAYPTAAVTGFQNGELLFTTALGLLAVSPAMAAFPRLSALAGNGEVSKA
RELLFRIMARLAVPLAFASAMLVALAPWIVGTLYAFTDHFSEANRAYTTQTVMALGFALL
PWGLNQLMLRGFYAVGQVGQAVGVTATIALLNTFGYWLLREQGLFVLNLATGLAGWLGLA
IYAQRLQVFQMVRPAQVWGITARATLAAAPAGGVAYLVAVQFGVPAFFLHNILPLALGGS
AGLLVFVGLAYALRLPLKLR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgcatccttcgcaacacccttctggtcatggccggtaccctcgccagccgcctg
ctgggccaggtgcgccagaccatcctgaccaaccttccgctcccagacaccaccaaggat
gccttctgggtggcctaccgcattcccaacctgctgcgcgagctgctggccgagggggcc
atccagaacgccctgattccggtgctgaccggccttccgcccgaagaggcccgcaccttc
gcccggcgttttggggcctttctgctgggggtaaatctggtaattctgggcctgggcctg
cttttcgcccctcaaattgccggcgcgctgttgtggctggccgagctatccctggcccag
cccagccccctgcgcgacccggcagtgttcgagcagttggtgctgctgattcgtttggtg
atgccatttttgctctcgatctcgatggcctcgctgttttcctcgatgctgcaatcgggc
gagcgctttggcctcaccagcttcagccccgtggccttcaacctgggctccattgccttg
atgctgttgtttcccagcagcattgcggccctgggtctgtcggttacgctggggggggcg
ttgcaagccctggtacagctacccgccctcaaaggctatggcctcgagttcaggtggcat
cccgccttccgcgccgccctgggccggattggccccttcgccttcaccacctcggtgcgg
cagtttttgaacctggttctgctgagcattctggccgcctaccccaccgccgccgtgacg
ggctttcaaaacggcgagctgcttttcaccaccgcgctgggcctgctggcggtctcaccg
gccatggccgcctttccccggctttccgccctggccggcaacggcgaggttagcaaagcc
cgcgagctgctcttccgcatcatggcacggcttgcggtgccgctggctttcgcctcggcc
atgctggtggctctagcaccttggattgtgggaacgctttacgcctttaccgaccacttc
tctgaggccaaccgggcctataccacccagaccgtgatggccctgggctttgcgctcctc
ccctggggcctgaaccagctcatgctgcggggcttctatgccgtggggcaggtgggtcag
gcggttggcgtgacggccaccatcgccttgctaaatacctttggctactggctgctgcgg
gagcagggtttgtttgtgctcaacctggccaccgggctggcgggctggctaggcctggcg
atctacgcccagcggctacaggtttttcagatggtacgcccagcccaggtatggggaata
accgccagggccacgctggccgccgcccctgcgggtggggtcgcctacctggtggcagtt
cagtttggagtcccggccttctttttacacaacatcctgccccttgccctgggggggtcg
gcaggcctgctggtgtttgtggggctggcctatgccctgcgcctgccgctcaagctgcgc
taa

DBGET integrated database retrieval system