KEGG   Meiothermus ruber DSM 1279: Mrub_0983Help
Entry
Mrub_0983         CDS       T01193                                 

Definition
(GenBank) nuclease SbcCD, D subunit
  KO
K03547  DNA repair protein SbcD/Mre11
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mrb03400]
    Mrub_0983
DNA repair and recombination proteins [BR:mrb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mrub_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metallophos Metallophos_2
Motif
Other DBs
NCBI-ProteinID: ADD27748
UniProt: D3PQL5
Position
complement(974456..975619)
Genome map
AA seq 387 aa AA seqDB search
MRILHTADWHLGKVLKGRERTPEIRQALQALLGLVRSERIELVLVAGDLFDRSVVSTEAE
AAAFEFFVGLRELQVPALVIAGNHDSRERLEALSPLLSLTGATVFGNLRFAEQGGVVEAL
GARVALLPFLSERRLVKAGDLLQGDGAEWKKTYGQGMGLILKNLATGFSGDLNLLMAHLT
VEGGQLGGGEFTFHTTNTYAIQPGDFPQTLSYVALGHLHRQQQVCEAPLAWYAGSLIQLD
FGEGENSDRGALIVEVAPGLPARVHPIRERWGKPLKTFRLSRETLDRRWEEVRTFPGYSK
IVIEGPGNAALRERLFKELPDLLEVEFHTPEAEIKGPTPVDTENLDWVEAYAEYRRTTTA
KEASPELLEAFKQVYEEAHTPSNQPAH
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattctgcacacagcagactggcacctgggcaaggtgctcaaagggcgggagcgc
accccggaaattcgacaggccttgcaagccctgttggggctggtgcgctccgagcgcatc
gagctggtgctggtggccggcgacctcttcgaccggagcgtggtgtccaccgaagccgag
gccgctgccttcgagttttttgtgggcctgcgcgagctgcaggttccggccctggtaatt
gccggcaaccacgacagccgcgagcgcctcgaggccctctcgcccctgctctccctgacc
ggggccaccgtgtttggcaacctgcgctttgccgaacagggcggggtggtggaggccctc
ggggcccgggtggcgctgctgccttttttgtcggagcgacggctggtcaaggcgggcgac
ctgctgcagggcgacggcgcggagtggaagaaaacctatggccagggcatgggcctgatt
ctgaaaaacctggctaccggctttagcggcgacctcaacctgctgatggcccacctgacc
gtggagggcggccagttggggggcggcgagttcacctttcacaccaccaacacctacgcc
atccagccgggcgactttccccagaccctgagctacgtggccctgggccatctgcaccgc
cagcagcaggtctgcgaggccccgctggcctggtatgcgggctctttgatccagctcgac
tttggtgagggagaaaacagcgaccggggcgccctgattgtggaggtggcgccaggctta
ccagcccgggtacaccccatccgtgagcgctggggcaagccgctcaaaaccttccggctg
agccgtgaaaccctggatcgccgctgggaggaggtgcggacttttcctggctacagcaaa
attgtgatcgaaggccccggcaacgccgccctgcgcgagcgattgttcaaggagctgccg
gatctgctcgaggtggagtttcacaccccagaggcagaaataaaaggccccaccccggta
gacaccgaaaacctggactgggtggaagcctatgccgaataccgccggacaaccaccgcc
aaggaggccagccccgaactgctggaggccttcaagcaggtctacgaagaggcccacacc
cccagcaaccagcccgcgcactga

DBGET integrated database retrieval system