KEGG   Meiothermus ruber DSM 1279: Mrub_0985Help
Entry
Mrub_0985         CDS       T01193                                 

Definition
(GenBank) cyclase family protein
  KO
K07130  arylformamidase [EC:3.5.1.9]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00380  Tryptophan metabolism
mrb00630  Glyoxylate and dicarboxylate metabolism
mrb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mrub_0985
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Mrub_0985
Enzymes [BR:mrb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.9  arylformamidase
     Mrub_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyclase
Motif
Other DBs
NCBI-ProteinID: ADD27750
UniProt: D3PQL7
Position
complement(976714..977316)
Genome map
AA seq 200 aa AA seqDB search
MIDITRPIHPGVPVWPGDTPFSYELVARIAGGDSVNVGKFTTTTHLGTHLDAPWHYVDDG
GKLESVPLEVLIGPCRVVDARGQEALTADFLKTIQLAERTLFYTGQPSIWPSFPHTFMHV
LPEAAGYMAAQGVRLYGTDAPSVDPLTSKDLPAHKAFAQAGVYIVEGLALEGVAPGDYEL
VCLPLKLEGADAAPVRAILR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacatcacccgccccatccaccctggcgtgccggtctggcccggcgataccccc
tttagctacgagctggtcgcgcgaatcgcaggcggcgacagcgtgaacgtgggcaaattt
accaccaccacccacctgggcacccacctcgacgccccctggcactacgtggacgacggc
ggcaagctggaaagcgtcccgctcgaggtgctcataggcccctgccgggtggtggatgcg
cgtggacaggaagccctcacggccgacttcctcaaaaccatccagctcgccgagcgcacc
ctcttttacaccggacagcccagtatctggccgagcttcccccacacctttatgcacgtg
ctgcccgaggccgccgggtacatggccgcgcagggtgtcaggctctacggcaccgacgcc
cccagcgtagaccccctcacctccaaagacctgcccgcccacaaggcctttgcccaggcc
ggggtttatatcgtggagggactggccctggagggggtggccccgggcgactacgaactc
gtctgcctgccgctgaagctcgagggggccgacgccgcgccggtgcgggccattttgcga
tag

DBGET integrated database retrieval system