KEGG   Meiothermus ruber DSM 1279: Mrub_1000Help
Entry
Mrub_1000         CDS       T01193                                 

Definition
(GenBank) putative beta-lactamase
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ADD27765
UniProt: D3PQN2
Position
complement(991526..992698)
Genome map
AA seq 390 aa AA seqDB search
MKPVRFMALLLFGLLLAVAQAPLSPKAALERLFTERPARAEWFAPAFLQQVPLAQVEAIL
QQLLGGLGRYEGVEPDGPNFRVNFERGVVPAQIALDSEGRIQGLFFRPPQPKAALTPEQL
LAEYRKLPGEVSVLVLEGPQERLSLNADRALAVGSSFKLAVLEALRQQIEAGQRRWSDTV
PLRPEWKSLPSGTLQNLPDGTPLSLEQYATQMISISDNTATDALISIVGRAEVEKLAPRN
RPFLTTREAFVLKNPQNREWLERYRANPAERAALLPQLARLPLPDVSVFAGGPVALDVEW
FFSTRELCALMGRVQALPLMSLNPGLANPADWQRVAYKGGSEPGVLNLTTWLTAKDGRQY
CVSATWNNPQARLDENQFFLLYTSLLNSLK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccggttcgctttatggccctgctgctgtttggtttgctactcgcggtagcgcag
gcccccctcagccccaaagcggctctcgagcgcctcttcaccgagcgcccggccagggcc
gagtggtttgccccggccttcttgcagcaggtgccgctggcccaggtggaagccattctc
cagcaactgctgggcgggctggggcgctacgagggcgtggagccggacggccccaacttt
cgggtgaacttcgagcgcggcgtggtgcccgcacagatcgcgctggacagcgaggggcgc
atccaggggctgttctttaggccgccccagcccaaggccgccctgacccccgagcagctc
ctggccgagtaccgcaagctaccgggagaggtcagcgtgctggtgctggaaggcccccag
gagcgcctgagcctgaacgccgaccgcgcgctggcggtgggctcgagcttcaaactagcc
gtgctggaagccctgcgccagcagatcgaagccgggcagcgccgctggagcgataccgtg
ccgctgcgcccggagtggaaaagcctgcccagcggcaccctgcaaaacctgcccgacgga
acccccctgagcctcgagcagtacgccacccagatgatctccatctccgacaacaccgcc
accgacgcactaataagcattgtcgggcgggccgaggtggaaaagctcgccccccgcaac
cggcccttcctgacgacccgcgaggcttttgtgctcaagaacccgcaaaaccgggagtgg
ctcgagcgctaccgggccaaccccgcggagcgggccgccctgctcccccaactggcccgc
ctgcccctgcccgacgtgagcgtgtttgccggggggccggtggcccttgacgtggagtgg
tttttcagcacccgcgagctgtgcgcgctgatgggccgggtacaggccctacccctgatg
tcgctcaaccccggccttgccaaccccgccgactggcagcgcgtggcctacaaagggggc
tccgagccgggcgtcctgaacctgaccacctggcttaccgccaaggatggcaggcagtac
tgcgtctcggccacctggaacaacccccaggcccggctcgacgaaaaccagttcttcttg
ctctacaccagcctgctaaacagcttgaagtag

DBGET integrated database retrieval system