KEGG   Meiothermus ruber DSM 1279: Mrub_1003Help
Entry
Mrub_1003         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YbjN
Motif
Other DBs
NCBI-ProteinID: ADD27768
UniProt: D3PQN5
Position
complement(996164..996571)
Genome map
AA seq 135 aa AA seqDB search
MDTVLREVTTEEVRILLDQFGLNAEQVKEDLFNLELPNGLRGHLITYGGSHVSSLQLRAG
FSGFDRVEPRHLLNWNRRYRFSKAYFDADNDPVLESDLRLEGVTPEAIHAFVHDFGDQVT
LFFSYLRMIDAGLVE
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggatacggttctgcgcgaagttaccaccgaagaggtgcgaattcttctggatcagttc
ggcctcaatgccgagcaggtcaaagaagacctgtttaacctagaactgcccaacggcctg
cgaggccacctgatcacctatgggggttcgcatgtgagcagcctacaattgcgggccgga
ttctcgggcttcgaccgggtagagccgcgccatctgctcaactggaaccggcgctaccgc
ttcagcaaggcctacttcgacgccgacaacgaccccgttttggaaagcgatctgcgcctg
gaaggggttaccccagaggccatccacgccttcgtgcacgactttggcgaccaggtcacc
ctatttttttcctatctacgcatgattgatgccggcttggtggagtag

DBGET integrated database retrieval system