KEGG   Meiothermus ruber DSM 1279: Mrub_1008Help
Entry
Mrub_1008         CDS       T01193                                 

Definition
(GenBank) RNA-binding protein (KH domain)
  KO
K06960  uncharacterized protein
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mrub_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KH_4 KH_2 KH_1
Motif
Other DBs
NCBI-ProteinID: ADD27773
Position
1001317..1001541
Genome map
AA seq 74 aa AA seqDB search
MFMKDLVEYLAKAVVDHPASIRVDERRGREGLVYYIETHPEDKGRIIGRQGRVIESIRTV
VRSFAKGRVSVEVR
NT seq 225 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgaaagacctcgtggagtacctggcaaaagcagtggtcgaccacccggcctcg
attcgcgtggatgagcgccggggccgcgaagggttggtgtactacatcgagacccacccc
gaggacaaaggccggattatcggccggcagggccgcgtaatcgagagcatccgcacggtg
gtgcgctcgtttgccaagggccgggtttcggtggaagtacgctga

DBGET integrated database retrieval system