KEGG   Meiothermus ruber DSM 1279: Mrub_1010Help
Entry
Mrub_1010         CDS       T01193                                 

Definition
(GenBank) tRNA (guanine-N1)-methyltransferase
  KO
K00554  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrb03016]
    Mrub_1010
Enzymes [BR:mrb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     Mrub_1010
Transfer RNA biogenesis [BR:mrb03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Mrub_1010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_m1G_MT Snurportin1
Motif
Other DBs
NCBI-ProteinID: ADD27775
UniProt: D3PQP2
Position
1002055..1002774
Genome map
AA seq 239 aa AA seqDB search
MKYTILTLFPDLVRPWTEESIVQKAIQKGLIEVDIRDIRAYTEDKHKTVDDTPYGGGAGM
VMRVDVVVRAIEAAGSADEVILLTPAGQPLTQRLVEELAGKSHLVLVCGRYEGIDARVEH
FVTREISIGDYVLMGGELGALVILEATARLLPGVIKEAESHRQDSFSTGLLDYPHYTRPP
VFRGLAVPEILTSGHHAKIAEWRRKQALKRTKARRPDLLERAELTPKDLVWLEESDFDN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaccatcctgaccctgttccccgatctggtgcgtccctggacagaagagtct
atcgtccagaaagccatccagaagggcctgattgaagtagatatccgcgatattagggcc
tacaccgaggacaaacacaaaaccgtggacgataccccctacgggggcggtgcgggtatg
gtgatgcgggtggatgtggtggtgcgggccatcgaggctgccggctccgccgacgaggtc
atactgctcacccccgccggccagcccctcacccagcggctggttgaagaactggccggt
aagtcgcacctggtgctggtgtgcggccgctacgagggcattgacgcgcgcgtagagcac
tttgtgactcgtgagatctcaatcggcgactacgttttgatggggggtgagctgggcgcg
ctggtgatcctggaagccacggcccgcctgctgccgggggtcatcaaagaggccgagagc
caccggcaggactccttctctacgggcttgctggactacccccactacacccgcccaccg
gtgttccggggcctggcggtgccggaaatcctcacctcggggcaccatgccaaaattgcc
gagtggcggcgcaaacaggccctcaaacgcaccaaagcccgccgccccgacctgctcgag
cgggccgagctaacccccaaggatctggtctggctcgaggaaagcgactttgacaactag

DBGET integrated database retrieval system