KEGG   Meiothermus ruber DSM 1279: Mrub_1017Help
Entry
Mrub_1017         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADD27781
Position
complement(1012143..1013276)
Genome map
AA seq 377 aa AA seqDB search
MREATIKLMKRLLLLTMAALLLGTSCNNRPAAPPPPPVIDPPTDGPLVFKYDAAEGYLDY
WYKDNAFGIGLHTYVEGLDGSWRVMTLPTLPYDNKVAPAFYRVQGLVTTEGYLVHYGLDQ
TLNKIYGGRKFRWKYRFKLHTQENPWRFEAPIGPVEFEVLERFPWEPGVQAAIIDTRNLF
LHNAIATSPIGAPPFIGCLQEDVPGIFNAKKGIYIASWHRGVIQWRDEDVDVTWPGPGNP
PWSYTRNWYWIDGEYEAYVATSNSNPIYITNGIQYNPRFPSLSNRTHEVILLSYADGVGP
YPKSWEKRYFRLAGRGAGAFLNPDGSVRCEFGEWRLDEITDPAAIAWFDAFRTSRREQPP
DGPMTPQQRAWLWPAGW
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaggctacaataaagctgatgaaacgattgctgcttctcaccatggccgcttta
ctgctcggtaccagctgcaacaaccgccccgctgccccgccgcccccgccggtgatcgat
ccgcccacggacgggccgctggtcttcaagtacgacgcggcggaggggtatctggactac
tggtataaggacaatgcgttcggcattgggctccatacctacgtggagggcctggatggc
agctggcgggtcatgaccctgcccaccctgccttacgataacaaggtcgcccccgccttc
taccgcgtgcagggcctggtcaccaccgagggctacctggtgcactacgggctggaccag
acgctcaacaagatctacggcgggcgcaagttccgctggaagtaccgcttcaagctgcac
acccaggagaacccctggcgcttcgaggcccccatcgggccggtggagttcgaggtgctg
gagcggtttccgtgggagccgggggtgcaggccgctatcattgataccagaaaccttttt
cttcacaacgcgatcgccacctcccccatcggcgcgccccccttcatcggctgcttgcag
gaggacgtacccggcatcttcaacgctaagaagggcatctacatcgcttcctggcaccgg
ggggtgatccagtggcgggacgaggatgtggacgtgacctggccggggccggggaatccg
ccgtggagctatacccgcaactggtactggattgacggggagtacgaggcctacgtggcc
accagcaactccaatccgatatacatcaccaacggcatccagtacaacccccgcttcccc
tccctctccaaccgcacccacgaggtgatcctgctctcctacgccgacggggtggggccc
taccccaagtcctgggagaagcgctacttccgcctggccgggcggggggcgggggccttc
ctgaaccccgacgggagcgtgcgctgcgagttcggggagtggcggctggacgagatcacc
gacccggcggccatcgcctggtttgatgccttccgcaccagcaggcgcgagcagcccccc
gacggccccatgaccccgcagcaacgggcctggctctggccggcggggtggtag

DBGET integrated database retrieval system