KEGG   Meiothermus ruber DSM 1279: Mrub_1018Help
Entry
Mrub_1018         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_33 HTH_23 HTH_29 HTH_28 HTH_32 HTH_Tnp_ISL3 DUF2802 HTH_38 Mor
Motif
Other DBs
NCBI-ProteinID: ADD27782
UniProt: D3PQP9
Position
1013344..1013856
Genome map
AA seq 170 aa AA seqDB search
MQLAQHQRRPRLELQLRHHPDHLHALYRESQDQTERARWHALWLLARGQSIPEVARNLGY
TDRWVRQVIHRYNQGLPMKNLRHENKGRAPLVPPELQEPFRQALLQPHPRDGLWSIRHAA
EWLAERLGRPVDGRRAWYWMRRLGLAPLRPRPRHREADAKRQEAFKKSSF
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgcaactggcccaacatcagcgccgcccccggttggaactccaactgcgacaccatccg
gatcacctccacgccctctaccgggagtcccaagaccagaccgaacgcgcccgctggcac
gctctctggctgctggccaggggtcagagcatccccgaggtagccaggaatctgggctat
accgatcgctgggtgcgtcaggtgatccaccgctacaatcagggcctgcctatgaagaat
ctgcggcacgagaacaaaggccgggcccccctcgtaccgcccgaactccaggaacccttc
cgccaggccctcctccagccccatcccagggacgggctttggagcatacgccacgcggcg
gagtggctggctgaaaggctgggacgtccggtggatgggcggcgggcctggtactggatg
cgtcgcctgggcctggccccgctgcgcccccggccgcgccaccgggaggcggatgcgaag
cggcaggaggctttcaaaaaaagctctttctga

DBGET integrated database retrieval system