KEGG   Meiothermus ruber DSM 1279: Mrub_1051Help
Entry
Mrub_1051         CDS       T01193                                 

Definition
(GenBank) TPR repeat-containing protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_12 TPR_1 TPR_8 TPR_16 TPR_2 TPR_MalT TPR_10 TPR_7 SNAP AAA_16 TPR_4 GD_AH_C TPR_19 NACHT
Motif
Other DBs
NCBI-ProteinID: ADD27815
UniProt: D3PQT2
Position
1049284..1051662
Genome map
AA seq 792 aa AA seqDB search
MLHTLGGLRLAGSNFGREKPLLLLAYLALEGPKPRRFLAELFWSEAADPLNSLAVALAKL
RKLGVAYSDESRAWVDLECDALALQDALRAGRWEEGIALYKGPFAEGLRSGEVGSELEEW
VYEVRERLAREVRQACLVLAEKAATQANFAEAAGYAEQAYRVAGAPPLEPEELPRVYRLL
LAGEHPLAETLEREARELGITLGGSSQAARGRLRQELVGRERELAALLALEEGAWAWVRG
GAGLGKTALLRELEVRTGWLYLPARSGLPYATLEPLLENPQGGEEALLRRAVQLRENLLL
DDWEQMDSESQRILTRLRGLRPPIRVVMAGQDAPPFAIDKLVELEPLTAEELAGFPGALE
ATGGIPALVGAWLRGEPIQTALEARLLGLSEQARQVYMSLALLETPDLFLVRQALNLSAS
EMAQAVDTLLSAGLIDLSGAVFGREAAQRYIAERPTLEARLSLGLARLLKPQQALPLYRR
AKALLEDADLPRLQQAYITWAQELICRGFPRRAAEELKEAPNHPEITLLRARAFERAGLY
KEALEVMRFMPDTPEHLALKATLYHRLGRADEAQACAERALSGGIEARAEAQNTLGLIFH
ARGDFQNAASAFRRAAALWLALGDENRRLGALNNLAVVRSRMGEDVEQVYREVFEIAKDN
PRVQAQILINLGKEFERQKRFVEALESYQQAERVAQESGNLRQAALAQNNIGVVFHITKE
VDSARIYYHRAIQAAREAGEVNVLAMALGNLAELDGDVEVWKEAIAVSENAGNYDLAQQH
KDLLRAFMERSG
NT seq 2379 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacacgctgggggggttgcggctggccgggagcaactttgggcgtgagaagccc
ctgttgctgctggcctacctggccctggagggccccaagccccggcggtttctggccgag
ctgttctggtcggaggccgccgaccccctgaactcgctggcggtggcactggctaagctg
cgcaagctgggggtggcctacagcgatgagagccgggcctgggtagacctcgagtgcgac
gccctggctttacaggacgcgctacgggcgggccgttgggaggagggcatcgccctgtac
aaggggccctttgccgaggggttgcgatcgggcgaggtggggagcgagctcgaggagtgg
gtctacgaggtgcgcgagcgcctggcccgcgaggtgcgccaggcctgcttggtgctggct
gagaaagcggctacccaggccaactttgccgaggccgcgggctatgctgagcaggcctac
cgggtggctggagcgccgcccctggagcccgaggagctgcccagggtctaccgcttgctg
ctggcgggcgagcaccccctggccgagaccctcgagcgcgaggccagggaactggggatt
accctggggggctcgagccaggccgcgcggggccgtctgcgccaggagctggtggggcgg
gagcgcgagctggcggccctgctggccctggaggagggggcctgggcctgggtgcggggt
ggggcggggctgggtaaaaccgctttgctgcgcgagctcgaggtgcgcacgggctggctt
tacctgccggcccggtctgggctgccctatgccaccctcgagcccctgctggaaaacccg
cagggcggcgaggaggctttgctgcggcgggcagtgcagttgcgcgaaaaccttttgctc
gacgactgggagcagatggatagcgaaagccagcggatattgacccgtttgcgcggcctg
cgtccccccatacgggtggtgatggcgggtcaggacgcgccgccttttgccatagataag
ctggtagagctggaaccgctcaccgccgaagaactggctggttttcccggtgccctcgag
gccaccgggggcatcccggccttggtgggggcctggttgcggggagaacccatccagacc
gcactggaagcccgcctcctgggcctaagcgagcaggcccgccaggtctatatgagcttg
gcgctgctggaaactccagatctctttttggtgcggcaagccctcaatctgagcgccagt
gagatggcccaggccgtagacaccctcctctcagccggcctgattgacctcagcggggct
gtgttcgggcgcgaggcggcccagcgctacatcgccgagcgccccaccctcgaggccaga
ctcagcctggggctggcccgcctgctcaagccccaacaggccctcccgctttaccgccgc
gccaaggccctgcttgaagatgccgacctaccccggcttcagcaggcctatatcacctgg
gcccaggagctgatttgccggggtttccccaggcgtgctgccgaagaactgaaggaagca
cccaaccaccccgagatcaccctgctgcgggcccgcgccttcgagcgagcaggcctgtac
aaagaagccctggaagtgatgcgcttcatgccggatactcccgagcacctggccctcaaa
gccaccctctaccatcgtttgggccgggccgacgaggcccaggcctgcgccgagcgagcc
ctgtcgggtggaattgaggccagggctgaggcgcagaacacgctgggcttgatttttcat
gcccggggcgatttccagaatgctgcgtctgcatttcgtcgtgcggctgcactctggctg
gctttgggggatgaaaaccggcgtttgggcgcattgaacaacctggctgtggtgcgttca
agaatgggagaagatgttgagcaggtctaccgggaagtatttgagatagcaaaagacaac
ccaagagtccaagcccaaatactgattaaccttgggaaagagttcgagcgacaaaagcgt
tttgtggaagcgctggaaagttaccagcaagccgagcgggttgcccaggaatcgggcaac
ctaagacaggctgctttggctcagaacaacataggcgttgtttttcacattacaaaagaa
gtggacagtgcccgcatttattatcaccgggctattcaagctgcacgtgaagccggggag
gtcaacgtattggcgatggccctgggtaacttggccgaactggatggcgatgttgaagtc
tggaaggaagccatcgccgtctcggagaacgcaggcaactacgatctagcccaacaacac
aaggatctcttgcgggcgttcatggagcgttcaggctag

DBGET integrated database retrieval system