KEGG   Meiothermus ruber DSM 1279: Mrub_1053Help
Entry
Mrub_1053         CDS       T01193                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00030  Pentose phosphate pathway
mrb00230  Purine metabolism
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01120  Microbial metabolism in diverse environments
mrb01130  Biosynthesis of antibiotics
mrb01200  Carbon metabolism
mrb01230  Biosynthesis of amino acids
Module
mrb_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mrub_1053
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mrub_1053
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     Mrub_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyltran Pribosyl_synth UPRTase
Motif
Other DBs
NCBI-ProteinID: ADD27817
Position
complement(1053364..1054359)
Genome map
AA seq 331 aa AA seqDB search
MGGASITEWLGSEQAEEIRHANGGQVKLFCGNANRPLAEAVARALGISLGKATVERFPDG
EVQVRLLESIRGDDVYLLQSTAPPVNDHLMELLVLADAARRSSAGRINAVIPYFGYARQD
KQTQGREPITARLVAGLLEHVGIHRVITVDLHAPQIQGFFYQPVDELSAVRLFAEYLERQ
NLTENAVVVSPDSGRAEQARRLSERLNLPLAILAKRRTGPRETQVSYVIGDVAGKRPLII
DDIISTGGTIRRGVEALLAAGAAPEVIVMASHAVLVGNARENLAHPAIREVVFTDTIALN
PALGYTILPTAPLLAQAIRRVHTNQSVSVLI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggggggcgcatcgataacagagtggctgggatcagaacaggcagaagaaatacggcac
gccaacggtgggcaggtcaaattgttttgcggcaacgccaaccgtcccttggccgaggcg
gtggcccgggccctgggcatctcgctcggcaaggccaccgtagaacgcttccccgacggc
gaggtgcaggtgcggcttttggagagcatccgcggcgacgacgtgtatctgctgcagtcc
accgcccctccagtcaacgaccacctgatggaacttctggtgctagccgacgcagcgcgc
cgcagcagcgcggggcgcatcaacgcggtgattccttatttcggctacgcccgtcaggac
aaacagacccaggggcgcgagcccatcaccgcgcgcctggtggcggggcttttggagcac
gtgggcatccaccgggtgatcaccgtagacctgcacgccccacagattcagggcttcttt
tatcaaccggtggacgagctctcggcggtgcggctttttgctgagtatctggagcgtcag
aacctcaccgaaaacgcggtggtggtctcgcccgactcggggcgggccgagcaggcccga
cggctctccgagcgcctgaacctgccgctggccatcctggccaaacgccgcaccggcccc
cgcgaaacccaggtgagctatgtgattggggacgtggcgggcaagcgtcccctgattatt
gacgacatcatctccaccggcggcaccatccggcgcggagtggaggccctgcttgccgcg
ggcgcggccccggaagtgattgtaatggcctcacacgccgtgctggtgggcaacgcccgc
gagaacctggcccaccctgccatccgcgaggtggtttttactgataccatcgcacttaat
ccggccctaggctataccatcctgcccaccgcccccctgctagcccaggccatccggcgg
gtgcataccaaccagtcggtgagcgtgctcatctag

DBGET integrated database retrieval system