KEGG   Meiothermus ruber DSM 1279: Mrub_1058Help
Entry
Mrub_1058         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: N_methyl
Motif
Other DBs
NCBI-ProteinID: ADD27822
UniProt: D3PQT9
Position
1059205..1059990
Genome map
AA seq 261 aa AA seqDB search
MRKPGITLVELLVALAILGVLMAAFAGFFVSTLRTTSDLDRRNELLLDGQIAHQLLVSRL
QEAWFVYPSGQAVTLNAPAAWQSTNPSSGSNLWTVGSNFVAAVLPPLRVGSACSPARPDQ
TDGCYRFFAYYPLHRAAYVANTANDILARLPAEPANAGGWVLMQYTAFLEPSAVVSGSTS
PTAGALSTMGGATTALVADYLTPGGSLFTVVDVAAGPPAIRQIKVTLQLSRTVQGRTIAV
GGPGTSLSSTVQPRNQGVLAP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacctgggattacccttgtcgaactgctggtggccctggccatcctgggggtt
ttgatggcagcgtttgccgggtttttcgtatccacactgcgtaccaccagcgacctggat
cgtcgtaatgagctgctactggatggtcagattgcccaccaattgctggtctcaaggctc
caggaggcttggtttgtatatcccagcgggcaggctgttacccttaacgcacctgcagca
tggcaaagcaccaacccgagctcgggaagtaatctctggactgtgggcagcaacttcgtg
gcggcggtgctgccccccttgcgggtaggttctgcctgcagccctgccaggcccgatcag
accgacggctgctaccgtttttttgcttactatcccctccaccgggcggcctatgtggcc
aatacggccaacgacatcctggcccgcttaccagccgaaccggccaacgcggggggctgg
gtgctgatgcagtacacggcttttctagaaccctcggcggtggtatcgggtagcacctcc
cccacggcgggggccttgagtaccatgggtggggcgacgacggctttggtggccgattat
ctgacgcccggtggctctcttttcactgtggtggatgtggccgcggggccgccagccatt
cgtcagataaaggtaaccctgcagcttagccgcaccgtccaggggcgaaccattgccgtg
ggtgggcccggcacctcgctgagctcgaccgtgcagccccgcaaccagggggtcttggcg
ccgtag

DBGET integrated database retrieval system