KEGG   Meiothermus ruber DSM 1279: Mrub_1059Help
Entry
Mrub_1059         CDS       T01193                                 

Definition
(GenBank) quorum-sensing autoinducer 2 (AI-2), LuxS
  KO
K07173  S-ribosylhomocysteine lyase [EC:4.4.1.21]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00270  Cysteine and methionine metabolism
mrb01100  Metabolic pathways
mrb01230  Biosynthesis of amino acids
mrb02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mrub_1059
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Mrub_1059
Enzymes [BR:mrb01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.21  S-ribosylhomocysteine lyase
     Mrub_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LuxS
Motif
Other DBs
NCBI-ProteinID: ADD27823
UniProt: D3PQU0
Position
complement(1060000..1060485)
Genome map
AA seq 161 aa AA seqDB search
MPKPLVIPESFRLDHTKVRAPYVRLAGVKETPKGDLIEKYDLRFAQPNQEALSTGAIHTL
EHLLATYIRSHLEGVVDISPMGCRTGFYLVVLGQPGPQKVLEAFRATLQDVVNHTEPVPG
VSELECGNYRDHDPQSAKAWAERLLHSNLHVQETIEIAQEA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaaccccttgtgatccccgagtcttttcgcctcgaccacaccaaagtccgggct
ccgtatgtgcggctggccggggtgaaggaaacccccaaaggcgacctgatcgaaaagtac
gacctgcgcttcgcccagcccaaccaggaggccctcagcaccggggccatccacaccctc
gagcacctcctggccacctatatccgcagccacctggaaggggtggtggatatctcaccc
atgggctgccgtaccggcttttacctggtggtgctgggccagccggggccccaaaaggtg
ctggaggcttttagggctacactacaggacgtggtcaaccacaccgagccggtgccaggg
gtgagcgagctcgagtgcggcaactaccgcgaccacgacccccaaagcgccaaggcctgg
gccgaacggctgctgcatagcaacctccatgtgcaggaaaccatcgagatcgcccaggag
gcctaa

DBGET integrated database retrieval system