KEGG   Meiothermus ruber DSM 1279: Mrub_1062Help
Entry
Mrub_1062         CDS       T01193                                 

Definition
(GenBank) TrkA-N domain protein
  KO
K03499  trk system potassium uptake protein
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mrb02000]
    Mrub_1062
Transporters [BR:mrb02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   Mrub_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_N TrkA_C NAD_binding_7 NAD_binding_10 Sacchrp_dh_NADP Pyr_redox Shikimate_DH Epimerase Pyr_redox_2 AlaDh_PNT_C F420_oxidored ApbA DUF1188 3HCDH_N NmrA XdhC_C NAD_binding_2 UDPG_MGDP_dh_N DAO DapB_N NAD_binding_8 HI0933_like FAD_binding_3 NAD_binding_9 LpxI_N
Motif
Other DBs
NCBI-ProteinID: ADD27826
UniProt: D3PQU3
Position
complement(1063472..1064809)
Genome map
AA seq 445 aa AA seqDB search
MYIVIAGGGEIGSQIAKALHTQHDLVVVDTNPEAKERLGGLDVQVVIGSVTDPEILREAK
VDLCDTFIATTNWDEVNLIACMLAKGLGAKETLCFVGKQSYVDILTDPRTVEILGTRIDQ
VFWPQRSLAKEIVEVIRIPGAVDTEVLAGGRLRFVEYQVREGGPYIGKQLALLDWPPGSL
LAGILREGRFIAATDPEFAQLALEAEDRIFFMTTPQGFDAIQACFAPRERVRRVMVVGGG
NVGYMVTKELLKHRLEVTVIDHNPDRCAWLAEHLPGALVLEGDGTDLELLESEGLDHVDV
MVAVTENDEKNLLVSLLAKQVGVAKVITRVNRGENRRLFEHVGIDIPLTPRAAAVREVVD
WIAPDNVDHLALIEDQVELLEFELPADFRETPFDKLQLPQGAIAVALERGTRVYLRSPML
AVTGGDKLLVLTDRQVANEVLAQVR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcgtaattgccggcggcggcgagatcggctcacagattgctaaagccctgcac
acccagcacgacctggtggtggtggacaccaaccccgaggccaaggagcgcctggggggg
ttggacgtgcaggtggtgattgggagcgtcaccgaccccgagattctgcgggaagccaag
gtagatctgtgcgacacctttatcgccaccaccaactgggacgaggtcaacctgattgcc
tgcatgctggccaagggcctgggggccaaggaaaccctgtgttttgtgggaaagcagtcc
tatgtggatatcctgaccgacccgcgcacggtggaaattctgggcacccgcatcgaccag
gtcttctggccccaacgctcgctggccaaagaaattgtagaggtcatccgaatccctggg
gcggtggacaccgaggtgctggccggtggccggttgcgctttgtggagtaccaggtgcgg
gagggcggcccctacatcggcaagcagctcgccctgctggactggcctccgggcagcctg
ctggccggtattttgcgcgagggccgttttatcgcggccaccgaccccgagtttgcccag
ctcgccctcgaggccgaggatcgcatcttcttcatgaccaccccccagggcttcgacgcc
atccaggcctgcttcgctccgcgcgaacgggtgcgccgggtgatggtggtggggggcggc
aatgtggggtacatggtcaccaaagaactgctcaagcaccgcctcgaggtcaccgttatt
gaccacaaccccgaccgctgcgcctggctggccgaacacctgccgggggcgctggtgctc
gagggcgacggcaccgacctggagctgctggagtccgaaggcctcgaccatgtggacgtg
atggtagcggtcaccgaaaacgacgagaaaaacctgctggtctcactcctggccaagcag
gttggggtagccaaggtgatcacccgggttaaccggggcgagaaccgccgcctcttcgag
cacgtgggcattgacatccccctcaccccccgcgccgcggcggtgcgcgaggtggtggac
tggatcgcccccgacaacgtagaccatctggcgctgatcgaagaccaggtcgagctgctg
gaattcgagctgccagccgacttccgcgaaacacccttcgataagctccagctcccccag
ggggccattgcggtggccctcgagcgcggtacccgggtctacctgcgctcccccatgctg
gccgttaccggtggcgataaactcctggttcttaccgaccggcaggtagccaatgaagtc
ctggcccaggttcgctaa

DBGET integrated database retrieval system