KEGG   Meiothermus ruber DSM 1279: Mrub_1078Help
Entry
Mrub_1078         CDS       T01193                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB
Motif
Other DBs
NCBI-ProteinID: ADD27842
UniProt: D3PQV9
Position
complement(1082298..1083191)
Genome map
AA seq 297 aa AA seqDB search
MLHIIGQVYQLYTRSHIPFFAAALAYYALFSLMPLLILLAGVFGFVLSGNEGLRNAVLVR
LIELVVLLFPTQPDLAQTLVNFLTRGAFPLTLASLLVLLWASSNFFAALAYALGIIFGGV
APRPEPAIPPTPTAKARPPQRAFGRAAALLTALRGRIAGLLAPLLLGLALILLALLGLVM
GFVLRYLPAELSFLRNGTEVVVPILGAMLLFFLTYMLLPIPTPRVLAAMAAATLAALAWE
GLRLGLPLLLPRTQYELIYGPIAGFLLALVGFYLTMWILLVGAVLAKALTERSSDTI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgctgcacatcatcgggcaggtttaccagctatacacgcgctcgcacatcccgtttttc
gcggcggcgctggcctactatgccctattcagcctgatgcccctgttgattctgctggcc
ggggtctttggctttgtgctctccggcaacgagggcctgcgcaacgcggtgctggtgcgg
ctcatcgaactggtggtgctgctcttccccacccagcccgacctggcccagaccctggtg
aactttctgactcgaggggcctttcccctcacgctggccagcttgctggtattgctgtgg
gccagcagcaatttctttgccgccctggcctatgccctgggcatcatctttggcggggtt
gccccacggcctgaaccggccatccccccaacgcccactgctaaagccaggcccccgcag
cgggctttcgggcgggcggcggccctgctgaccgccctgcgcgggcgcatcgcgggcctg
ctggcccccttgctgctgggactggccttgattctgctggccctgctggggctggtcatg
ggctttgtgctgcgctacctgcctgcagaactcagctttttgcgcaatggaacagaggtg
gtggtgcccattctgggggcgatgctgctcttctttctgacctatatgctgctgcccatc
cccacccccagggtgctggccgctatggccgcggctaccctggcggctctggcctgggag
gggctgcgcttagggctgcccctgctgctgccccgcacccagtacgagctgatttacggg
cccattgcggggtttttgctggcgctggtgggcttttacctaaccatgtggatcctgctg
gtgggggccgttttagctaaagctctgaccgagcgctcgagcgacacgatataa

DBGET integrated database retrieval system