KEGG   Meiothermus ruber DSM 1279: Mrub_1084Help
Entry
Mrub_1084         CDS       T01193                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose reductase
  KO
K00067  dTDP-4-dehydrorhamnose reductase [EC:1.1.1.133]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00521  Streptomycin biosynthesis
mrb00523  Polyketide sugar unit biosynthesis
mrb01130  Biosynthesis of antibiotics
Module
mrb_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mrub_1084
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mrub_1084
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.133  dTDP-4-dehydrorhamnose reductase
     Mrub_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RmlD_sub_bind Epimerase GDP_Man_Dehyd Polysacc_synt_2 NAD_binding_10 3Beta_HSD NAD_binding_4
Motif
Other DBs
NCBI-ProteinID: ADD27848
UniProt: D3PQW5
Position
1090364..1091215
Genome map
AA seq 283 aa AA seqDB search
MRVFVTGGTGYLGSTLLRLGSGRPWVLGASYWSQPPAVPGVAWVRLDVRDAAAVEQALKE
FRPEVVIHTAYSKASPAALEAITVQGTVHVARACRALGARLIHLSTDQLFDGENPPYAES
AAPNPLTEYGQAKLRAEHWVQAILPTATIVRTSLIWGLNPLDVTSQMVLELADGKREGGL
FSDEYRSFVYVEDLAQALGELVGLDYAGILHLGGAEVLSRLEFGRLIAPFHGRDPARLPA
QRRAEFPGLRPGNCALDSSLAQSLLQTRLRGVREVLRAHRPVG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtttttgtgaccgggggaaccggttatttagggagtacgctgctgcggctgggg
tcgggtcggccctgggttttgggtgccagttactggagccagccgccggcggtgccgggg
gtggcctgggtgcggctggatgtacgggatgcggcggcggtggagcaggccttgaaggag
tttcgtcccgaggtggtcatccacaccgcctacagcaaggccagtccagcggcgctcgag
gccatcaccgtacagggcacggttcatgtggcccgggcctgccgggctcttggggcccgg
ctgatccacctctccaccgaccagcttttcgatggcgaaaacccgccctatgccgagtcg
gctgcgcccaaccccctcaccgagtacggccaggccaagctcagggccgaacactgggtg
caggcgatactccccaccgccaccatcgtccgcacctcgctcatctggggcctgaacccc
ctcgacgtgaccagccagatggtgctggagttggccgatggcaagcgggagggcgggctt
tttagcgacgagtaccgctcctttgtgtacgtagaggatctggcccaggccctgggggag
ctggtgggtctggactatgcgggcatcctgcacctggggggtgcggaggtgttgagccgg
ctcgagtttggacgactgattgcccctttccacggacgcgacccggcccgacttccggcc
cagcgccgcgccgagtttcccggcctacgtcccggtaattgtgcgctggatagctcgctg
gctcagtccctgctccagacccggctgcgcggggtgcgggaagtgttgcgcgcgcaccgc
cctgtgggataa

DBGET integrated database retrieval system