KEGG   Meiothermus ruber DSM 1279: Mrub_1085Help
Entry
Mrub_1085         CDS       T01193                                 

Definition
(GenBank) hypothetical protein
  KO
K09680  type II pantothenate kinase [EC:2.7.1.33]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00770  Pantothenate and CoA biosynthesis
mrb01100  Metabolic pathways
Module
mrb_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mrub_1085
Enzymes [BR:mrb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.33  pantothenate kinase
     Mrub_1085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fumble BcrAD_BadFG Peptidase_M22 UPF0060
Motif
Other DBs
NCBI-ProteinID: ADD27849
UniProt: D3PQW6
Position
1091246..1092067
Genome map
AA seq 273 aa AA seqDB search
MLKLGVDFGLSNTDVVLLEGETILAHQTIKTGPASSQALAAVLQSLGVRPAELATIASTG
GLSRRLPDALEGIPIQKIGEAQAVGRGALRLAGLDEALVVSAGTGTAMIAARGSEAQHFT
GSAVGGGTLLGLSRLLLGTADPLEVARLAERGNPSGVDSTLVDVIGGGIGHLPPDATAVN
FGRLVDGVNPSREDLAAGLVTLVGQVIAMIALNAVQAAGLKQMVIVGHLPDLAPVRKAFE
RVWYFYQVEPRPLIPPLAGWATAYGAALLAQEV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaacttggcgtggattttggtctttccaacaccgatgtggtgctgctcgagggc
gagaccatcctggcgcaccaaaccatcaaaaccgggccggccagcagccaagccctggcc
gccgtgttgcaaagcctgggggtgcggcccgccgaactcgccaccatcgccagcaccggg
ggtttatcgcgccgcctgcccgatgccctcgaggggattcccatccagaaaatcggtgag
gcccaggcagtggggcggggggcgctgcggctggcgggcctggacgaggccctggtggtc
tcggcgggcaccggcacagccatgattgctgccaggggtagtgaagcccagcacttcacc
ggctcggcggtggggggtggaaccttgctgggtttgtcccggctgctgctagggacggcc
gatcccctcgaggtggcccgcctggccgaacggggcaaccccagcggtgtggattcaact
ttggtggacgtgattggcggtggcatcggccacctgccccccgatgccaccgcggtcaac
tttggccggctggtggatggtgtcaaccccagccgcgaggatctggccgccggcctggtg
acgctggtaggccaggttatcgccatgattgccctcaacgcggtgcaggctgcggggctc
aagcagatggtgatcgtgggccacctgcccgacctggcgcccgtgcgcaaggcctttgag
cgggtctggtacttttaccaggttgagcccagacccctcattccccccttggccggctgg
gccacggcctacggggccgcgcttttggcgcaggaggtttga

DBGET integrated database retrieval system