KEGG   Meiothermus ruber DSM 1279: Mrub_1087Help
Entry
Mrub_1087         CDS       T01193                                 

Definition
(GenBank) tRNA/rRNA methyltransferase (SpoU)
  KO
K03437  RNA methyltransferase, TrmH family
Organism
mrb  Meiothermus ruber DSM 1279
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrb03016]
    Mrub_1087
Transfer RNA biogenesis [BR:mrb03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Mrub_1087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SpoU_methylase TSNR_N SpoU_sub_bind Cadherin_2
Motif
Other DBs
NCBI-ProteinID: ADD27851
UniProt: D3PQW8
Position
1092540..1093340
Genome map
AA seq 266 aa AA seqDB search
MRITSTANPRIKAAAELKERKNRERTGTFLIEGAREIERALAAGLEVIEAYCGEPLSPEE
ARAVAHLSRALGLEVHELSEAALKKISSREHPAGVLAVARMPRPSLAAFQPSSNALLLVS
VGLEKPGNLGALLRSADAAGADAVLVAGGVDLYSPQVIRNSTGVVFSLPTFAAPEQAVLD
WLLQHNIPIVATTPHTHQTYWDVDLRGPVAIVLGTEHQGLSQTWLERAARKVRIPMQGQA
DSLNVSVTAALMLYEAVRQRQPRPLP
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattacctcaacggccaacccccgcatcaaggcggctgctgaactcaaagaacgc
aagaaccgcgagcgaacgggtacgtttttgattgaaggcgctcgcgaaatcgagcgggcg
ttggcagccggcctcgaggtcatcgaagcctactgcggcgagcctctcagccccgaggag
gcccgcgccgttgctcatttatctcgagccctcggcctggaggtgcacgagctttccgag
gcagccctcaagaaaatcagcagccgcgagcacccggccggggtgctggcggtggcccgg
atgccccgcccttcccttgcggccttccagccttcttccaatgctttgctgctggtctcg
gtggggctggaaaaacccggcaacctgggggctttgctgcgctcagccgacgccgccggg
gccgatgcggtgctggtggcggggggggtagacctctacagcccccaggtcatccgcaac
tccaccggggtggtgttttccttgcctacctttgccgcccccgagcaggccgtgctggac
tggttactgcagcacaatatccccatagtagccaccaccccccacacccaccaaacctac
tgggacgtggatctgcgggggcctgtggccattgtgctgggcacggaacaccaggggttg
agccaaacctggctcgagcgggccgcacgaaaggtcaggattcccatgcagggccaggcc
gacagtcttaacgtctcggtaacagccgccctgatgctatatgaggctgtacggcagcgc
caaccccgcccgttgccttag

DBGET integrated database retrieval system