KEGG   Meiothermus ruber DSM 1279: Mrub_1096Help
Entry
Mrub_1096         CDS       T01193                                 

Definition
(GenBank) acyl-CoA dehydrogenase domain protein
Organism
mrb  Meiothermus ruber DSM 1279
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_2 Acyl-CoA_dh_M Acyl-CoA_dh_N HpaB_N
Motif
Other DBs
NCBI-ProteinID: ADD27860
UniProt: D3PQX7
Position
1099829..1101022
Genome map
AA seq 397 aa AA seqDB search
MTAQTTDLALEVRRFLEAEVLPLEPIFLKHGFKAVLPELERVRQKVKEKGWWLPPLQKPL
GMGLGLGVFARLSEELGRSPLGHYVFNTQAPDIGNMEVLLKHGTPEQKARFLEPLAKGEV
RSSFGMTEPGYPGSNPVWMNTRAVLEGDQWVINGHKWYTTGFEGSSFCIVMCITDPEQPN
PYARASQIIVPTDAPGFQQVRKISVMGEEGEDWMSHSEIRLENVRVPQENLLGARGKGFA
IAQERLGPGRIHHCMRWIGIAQRSLELMCAYAARRELAPGKPLGSRQAIQHLIAESQAEI
HAARLMVLDAAEKVEQKGAEGARVEISLIKFFVAGVLQRVLDRAIQVHGGLGMSDDLPLS
FFYRHERAARIYDGADEVHKTVVARALLKDYGLDISL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacaaaccaccgacctggcgctggaagttcgcaggttcctcgaggccgaggtg
ctgcccctcgagcccatcttcctgaagcacggcttcaaggccgttctgcccgagctggag
cgggttcggcaaaaggtgaaggaaaagggctggtggctgcccccgctgcaaaagccgctg
ggtatgggcctgggcctgggggtctttgcccgcctgagcgaggagctgggccgcagcccc
ctgggccactacgtcttcaacacccaggcccccgacatcggcaatatggaggtgctgctc
aaacacggcacgccggagcagaaagcgcgttttctggagcctttggcaaagggcgaggtt
cgcagttcctttggcatgaccgagcccgggtaccccggttccaacccggtctggatgaac
acacgggcggtgctcgagggcgaccagtgggttatcaatgggcacaaatggtacaccacc
ggcttcgagggctcgagcttctgtatcgtgatgtgcatcaccgaccccgagcagcccaac
ccctacgcccgggccagccagatcatcgtgcccaccgatgcccccggcttccagcaggtg
cgcaaaatctcggtgatgggggaggagggcgaggactggatgagccactccgaaatccgg
cttgaaaacgtgcgggtgccccaggagaacctgctgggtgcgcgcggcaagggcttcgcc
atcgctcaggagcggctggggccggggcgcatccaccactgcatgcgctggattggcatc
gcccagcgcagcctcgagctgatgtgcgcctacgccgcccggcgcgagcttgcccccggc
aagcccctgggttcgcgccaggccatccagcacctgatcgccgagtcccaggccgagatt
cacgcggcccggctgatggtgctggatgctgccgagaaggtcgagcaaaaaggggccgag
ggggctcgagtggaaatctcgctcatcaaattctttgtggctggggtgttgcagcgggtg
ctggaccgggccatccaggtgcatgggggcctggggatgtccgacgacctgccgctctcg
ttcttctaccgccacgaacgggccgcccgcatctacgatggggccgacgaagtccacaag
accgtggtggctcgagccctgctcaaggactatggcctggatatctcgctctga

DBGET integrated database retrieval system