KEGG   Meiothermus ruber DSM 1279: Mrub_1533Help
Entry
Mrub_1533         CDS       T01193                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00020  Citrate cycle (TCA cycle)
mrb00310  Lysine degradation
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01120  Microbial metabolism in diverse environments
mrb01130  Biosynthesis of antibiotics
mrb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mrub_1533
  Amino acid metabolism
   00310 Lysine degradation
    Mrub_1533
Enzymes [BR:mrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mrub_1533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADD28295
UniProt: D3PS62
Position
complement(1567686..1568873)
Genome map
AA seq 395 aa AA seqDB search
MALELKIPAVGESITEVEIGQWLKKEGDTVKVDEPLVELVTDKATLELPAPVAGRLTKIL
IPSGQAKVGDVVALLEEGAAEASSGAPSQSTPAPSQAAATESKVMPAAERLAAQAGLQAS
SIPGSGPGGRVLKEDVQRAVTTPPPTPQPTPSAPPAPPVQKGERREDVVPMTPLRRRIAE
RLLAAKQNTAMLTTFNEADMSAVMELRKEYGEAFQKKYGFKLGFMSFFVKAVVQALQEIP
QLNAEIRGTDIVYHRYYDIGIAVGGGEGLVVPVIRDADRLSMAQIEAVIADFGARVREKK
IKPEELMGGTFTITNGGIYGSLNSTPILNPPQVGILGMHAIVERPVAKNGAVVIRPMMNL
ALSYDHRIVDGREAVTFLKRIKELIENPVRLTLEI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggccttagaactgaaaatacctgcagttggcgagtccatcaccgaagttgagattggt
cagtggcttaagaaggaaggggacacggttaaggttgatgagcccctggtggaactggtt
accgataaagccaccctcgagctgcccgcaccggtggccgggcggctgaccaaaatcctc
atccccagtggacaggccaaggtgggcgatgtggtagccctgctggaagaaggcgccgcc
gaagcctcgagcggcgcccccagccagagcaccccggcccccagccaggccgcggccacc
gagagcaaggtgatgccggcagccgagcgactggcggcacaggccggcctgcaggcctcg
agcattccgggtagcggcccgggcggccgggtcttgaaagaagacgtacagcgagcggta
accacaccgccccccaccccgcaacccacgcccagcgccccgcccgccccgccagtacaa
aaaggcgaacgccgcgaggatgtggtgcccatgacccccctgcgccgccgcattgccgag
cgtttgctggcagccaagcagaataccgccatgctcaccaccttcaacgaggccgatatg
agcgcggtgatggagctgcgcaaggagtacggcgaggccttccagaagaaatacggcttc
aagctgggctttatgagcttttttgtgaaagcggtggtgcaggccctgcaggaaatcccg
cagctcaacgccgagatccgcggaaccgatatcgtttaccaccgctactacgacatcggc
atcgccgtgggcgggggcgagggcctggtggtaccggtgattcgcgatgccgaccggctc
tcgatggcccagattgaggcggtaattgccgactttggagccagggtacgggaaaagaaa
atcaaacccgaagagttgatgggcggtaccttcaccatcaccaacgggggcatctacggc
tcgctcaactccacgcccattctcaatccgccccaggtgggcatcctgggcatgcacgcc
atcgtcgagcgtccggttgccaaaaacggcgcagtggtcatccgcccgatgatgaacctg
gccctttcctacgatcaccgcattgtggatgggcgggaggccgtcaccttcctcaagcgc
atcaaggaactcatcgaaaaccccgtacggctaaccctggaaatctaa

DBGET integrated database retrieval system