KEGG   Meiothermus ruber DSM 1279: Mrub_1738Help
Entry
Mrub_1738         CDS       T01193                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00350  Tyrosine metabolism
mrb00360  Phenylalanine metabolism
mrb00380  Tryptophan metabolism
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Mrub_1738
   00360 Phenylalanine metabolism
    Mrub_1738
   00380 Tryptophan metabolism
    Mrub_1738
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mrb04147]
    Mrub_1738
Enzymes [BR:mrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     Mrub_1738
    4.1.1.105  L-tryptophan decarboxylase
     Mrub_1738
Exosome [BR:mrb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mrub_1738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ADD28498
UniProt: D3PSR5
Position
complement(1793443..1794867)
Genome map
AA seq 474 aa AA seqDB search
MTPEEFRRLGYQLIDFIAEYRASLEALPVMSQASPGSIKALFPASPPAQAVGLAGVQEGL
RALFPGLTHWQSPNFYAWFPSNAPLSSVLADLVATGLGQTGITWQASPALTEVEEVMTDW
LRQMFGLPDCFQGVIQDTASTGTLVALLTAREWATDQSQDRGGLQAEARPLTVYVSDQAH
SSVPKAALLAGFGRENLRLIETDEDHAMRADLLEAAIERDLAEGRRPCAVVAAVGTTNTT
AIDPVRAIAELCRKYGLWLHVDAAMAGAAMILPECRGLWDGIEHADSIAINPHKWLGVAF
DCSLYYVRAPEHLIRAMSTNPSYLHSTADGQVKNYKDWGIPLGRRFRALKIWFTLLDQGV
EGLQARLRRDIANARWLEAQVRQTPGWELLAPVPLQTLCLRYNPAGLSPAQVDRHTQDWV
ARINRSGRAFLTPALLKGRWMVRVSIGAESTERRHVESLWALMQQEAQKVQIES
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacacccgaagagttcagacgcctggggtaccaattgattgatttcatcgctgagtat
cgcgcaagcctcgaggccctgccggtaatgtcgcaagcttcacccggaagcatcaaagcc
ctgtttccggcttcaccgcccgcacaggccgtgggactggcaggggtgcaggaggggctc
agggccttattcccgggtctgacccattggcaaagtcccaatttttatgcctggtttccc
tccaacgcgccgctctcttcggtgctggccgatctggtggctaccggactgggccagacc
ggcatcacctggcaggccagcccggccctgaccgaggttgaggaggttatgaccgactgg
ctgcgccagatgtttggcctgcccgattgctttcaaggggtcattcaggataccgcctcc
accggtacgctggttgcgctgctgaccgcccgggagtgggcgacggatcagtcccaggat
cggggtgggctgcaggccgaggcccggcctcttaccgtgtacgtctccgaccaggcccac
agctcggtgcccaaggcggctttgctggccggttttgggcgcgagaacctgcgccttatc
gagaccgacgaagaccatgccatgcgtgcagacctgctcgaggccgccatagagcgcgac
ctggccgagggccgcaggccctgcgcggtggtggcggcggtgggtacgaccaacaccacc
gccatcgatccggtgcgggccattgccgaactgtgccggaagtatggtctctggctgcac
gtggatgcagccatggccggtgcggccatgattctgccggagtgccggggcctgtgggac
ggcatcgagcacgccgactccatcgccatcaacccccacaagtggctgggggtggctttc
gactgctcgctctactacgtgcgtgcgcccgagcatctgatccgggccatgtccaccaac
ccctcctacctgcactcgacagccgatggtcaggtaaaaaactacaaagactggggaatc
ccgttggggcggcgcttccgggccctgaagatctggttcaccctgctcgaccaaggggtc
gagggcctgcaagcccggctaaggcgtgatatagccaatgcccgctggctcgaggcccag
gttcgccagacccccggctgggagctgctggcgccggtgccgcttcagaccctgtgcctg
cgctacaaccctgccggcctgagcccagcgcaggtggatcggcacacccaggactgggtg
gcccgcatcaaccgttctggccgggccttcctgaccccggctctgctcaaagggcgctgg
atggtacgggtctcgattggagctgagtccaccgaacgccgtcatgtggagtcgctgtgg
gccctgatgcagcaggaagcccagaaggtgcaaattgaaagctga

DBGET integrated database retrieval system