KEGG   Meiothermus ruber DSM 1279: Mrub_2614Help
Entry
Mrub_2614         CDS       T01193                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Mrub_2614
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mrb03011]
    Mrub_2614
Ribosome [BR:mrb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Mrub_2614
  Bacteria
    Mrub_2614
  Archaea
    Mrub_2614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ADD29364
UniProt: D3PN37
Position
complement(2652853..2653350)
Genome map
AA seq 165 aa AA seqDB search
MEARKRLKKGERSDIRKDLRDVHYPSSAGLQRYAKLSLRKRAEALKEEKPHTYAMATARY
VRMSPRKVRLVVDLIRGKKLEEARAILKYTPHRASEVVAKVLESAAANGMNDDRKNMIED
QIYVKAAYVDEGPAIKRVLPRARGSANMIKKRTSHITIIVGEKNG
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggaagctagaaaacgtcttaagaaaggcgagcgcagcgatatccgcaaagacctgcgc
gacgtgcactaccccagctcggcgggcttgcagcgctacgccaagctctcgttgcgcaaa
cgtgcggaggccctcaaggaagagaagccccacacctatgctatggccacagcccgctac
gtccgcatgtcgccgcgaaaagtgcgcctggtggtagacctgatccggggtaagaagctc
gaggaagcccgggccatcctcaaatacaccccccaccgggcttcggaagtggtagccaag
gtgctcgagtcggccgcggccaatggcatgaacgacgaccgcaaaaacatgatcgaagac
cagatctatgtcaaggcggcctatgtggacgagggcccggccatcaagcgggtgctgcct
cgagcccgcggtagtgccaacatgattaagaaacgtaccagccacatcaccatcatcgtg
ggggagaaaaatgggtaa

DBGET integrated database retrieval system