KEGG   Methylobacterium radiotolerans: Mrad2831_0006Help
Entry
Mrad2831_0006     CDS       T00674                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00071  Fatty acid degradation
mrd00280  Valine, leucine and isoleucine degradation
mrd00281  Geraniol degradation
mrd00310  Lysine degradation
mrd00362  Benzoate degradation
mrd00380  Tryptophan metabolism
mrd00410  beta-Alanine metabolism
mrd00640  Propanoate metabolism
mrd00650  Butanoate metabolism
mrd00903  Limonene and pinene degradation
mrd00930  Caprolactam degradation
mrd01040  Biosynthesis of unsaturated fatty acids
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01130  Biosynthesis of antibiotics
mrd01200  Carbon metabolism
mrd01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mrad2831_0006
   00650 Butanoate metabolism
    Mrad2831_0006
  Lipid metabolism
   00071 Fatty acid degradation
    Mrad2831_0006
   01040 Biosynthesis of unsaturated fatty acids
    Mrad2831_0006
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mrad2831_0006
   00310 Lysine degradation
    Mrad2831_0006
   00380 Tryptophan metabolism
    Mrad2831_0006
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mrad2831_0006
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mrad2831_0006
   00281 Geraniol degradation
    Mrad2831_0006
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mrad2831_0006
   00930 Caprolactam degradation
    Mrad2831_0006
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mrad2831_0006
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mrad2831_0006
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mrad2831_0006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 UDPG_MGDP_dh_N NAD_binding_2 DAO F420_oxidored FAD_binding_3 Pyr_redox_2 2-Hacid_dh_C Sacchrp_dh_NADP NAD_binding_8 NAD_Gly3P_dh_N GIDA AlaDh_PNT_C NAD_binding_7 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ACB22033
UniProt: B1M570
Position
5304..7505
Genome map
AA seq 733 aa AA seqDB search
MTLTDFRFETDPDGIALATWDMPGRSMNVITEGVMDHLEQIIEQVASDPTIKGCVIATGK
DNFSGGADLTMLQGLGRAYEQLKAEQGEEVAMRHFFEASRRLSLLFRRLETCGKPFAAAI
QGLCLGGAFELALSCHYRVASDDGKTRVGLPEIKVGLFPGGGGTQRVARLMQTGDALQML
FKGEQIRAPMAKGMGLIHAVAPQAEIVERAKAWIREGGSAVAPWDVPKFKAPSGKVYSPA
GMMIWPPANAIYRRETHDNYPAAKAILASVYEGLQLPMDLALRVESRYFAHILRSTEAAA
MIRTLFISMGELNKGARRPKDVPATNLRKVGVIGAGFMGAGVAYVTAQAGIEVVLVDQSV
EAAEKGKAYAHTLITGQINKGRAKTADREALLGRIQATADYGALAECDLVIEAVFEDPRV
KAEVIQKVEAVIRPDAIFASNTSTLPITGLAKASQRPAQFVGIHFFSPVEKMMLVEIIKG
EATGDAALAAALDYVRLIKKTPIVVNDARGFFANRCVGAYILEGHKMLAEGVPPAMIESA
GRQAGMPVGPLSLNDEVALDLVLKIAKATEAQVGQGAVDPAQKAILAEMVENQGRLGRKN
RKGFYDYPEGAPKRLWPGLRDLQPNRLDPDAVDFTELKQRLLVVQALEAARTVGEGVVTD
PREADVGSILGFGFAPFTGGTLSYIDFMGAAAFVDLARSLEAKHGPRFHVPDNLAAMAER
GGTFYAGAEKRAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaccgatttccgcttcgagaccgatcccgacggcatcgctctggcgacctgg
gacatgcccggccgctcgatgaacgtcatcaccgaaggcgtgatggaccacctcgagcag
atcatcgagcaggtcgcgtccgatccgacgatcaagggctgcgtcatcgccaccggcaag
gacaatttctccggcggcgccgacctcaccatgctgcagggcctcggccgggcctacgag
cagctgaaggccgagcagggcgaagaggtggcgatgcgccacttcttcgaggcctcccgg
cgcctatcgctgttgttccggcggctggagacctgcggcaagcccttcgccgcggccatc
cagggcctgtgcctgggcggcgccttcgagctggcgctgtcgtgccactaccgggtcgcg
tccgacgacgggaagacccgcgtcggcctgccggagatcaaggtcggcctgttcccgggc
ggcggcggcacgcagcgggtcgcgcgcctgatgcagaccggcgacgccctccagatgcta
ttcaagggcgagcagatccgcgcgcccatggccaagggcatggggctgatccacgcggtg
gcgccgcaggccgagattgtggagcgcgccaaggcctggatccgcgagggcggctcggct
gtggcaccctgggacgtgccgaagttcaaggcgccgtccggcaaggtctactcgcccgcc
ggcatgatgatctggccgccggccaacgccatctaccgccgcgagacgcacgacaactac
cccgccgccaaggcgatcctggcctccgtctacgagggcctgcagctgccgatggacctc
gccctgcgggtcgagagccggtacttcgcgcatatcctgcgctcgaccgaggcggcggcg
atgatccgcacgctgttcatctccatgggcgagctgaacaagggcgcgcgccgcccgaag
gacgtgccggcgacgaacctccgcaaggtcggcgtgatcggtgccggcttcatgggcgcg
ggtgtcgcctacgtcaccgcccaggccggcatcgaggtggttctcgtcgaccagtccgtc
gaggccgccgagaagggcaaggcctacgcccacaccctgatcaccggccagatcaacaag
ggccgggccaagacggccgaccgggaggcgctgctcggccggatccaggccacggcggat
tacggcgccctcgccgagtgcgacctcgtgatcgaggccgtcttcgaggatccgcgcgtg
aaggccgaggtgatccagaaggtcgaggcggtgatccgccccgacgcgatcttcgcgtcc
aacacctcgaccctgccgatcaccgggctggccaaggcgtcgcagcggccggcgcagttc
gtcggcatccacttcttctcgccggtggagaagatgatgctcgtcgagatcatcaagggc
gaggcgaccggggacgcggcgctcgccgccgctctcgactacgtgcggctgatcaagaag
accccgatcgtcgtcaacgacgcccgcggcttcttcgccaaccgctgcgtcggcgcctac
atcctcgaggggcacaagatgctcgccgagggcgtgccgcccgcgatgatcgagagcgcc
ggccgccaggcgggcatgccggtcgggccgctgtcgctcaacgacgaggtcgccctcgac
ctcgtgctcaagatcgccaaggccaccgaggcgcaggtggggcagggcgccgtcgacccg
gcgcagaaggcgatcctcgccgagatggtcgagaatcagggccggctcggccgcaagaac
cgcaagggcttctacgactaccccgagggcgcgccgaagcgcctctggcccggcctgagg
gacctgcagccgaaccgcctcgatcccgacgccgtcgacttcaccgagctgaagcagcgg
ctcctggtggtccaggcgctggaggccgcccgcacggtcggtgagggcgtggtcaccgat
ccgcgcgaggccgatgtcggctcgatcctcggcttcggcttcgcgccgttcaccggcggg
accctgtcgtacatcgacttcatgggcgcggcggccttcgtcgacctcgcgcggtcgctc
gaggccaagcacgggccccgtttccacgtgcccgacaacctagccgcgatggccgagcgc
gggggcacgttctacgccggcgccgagaagcgcgccgcctga

DBGET integrated database retrieval system