KEGG   Methylobacterium radiotolerans: Mrad2831_0104Help
Entry
Mrad2831_0104     CDS       T00674                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00330  Arginine and proline metabolism
mrd00332  Carbapenem biosynthesis
mrd01100  Metabolic pathways
mrd01130  Biosynthesis of antibiotics
mrd01230  Biosynthesis of amino acids
Module
mrd_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mrad2831_0104
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Mrad2831_0104
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mrad2831_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACB22131
UniProt: B1M696
Position
complement(109859..110974)
Genome map
AA seq 371 aa AA seqDB search
MIPALEEFRRVVIKVGSALLVDRSAGRLRHAWLAALAEDIAELHGRGVDVLVVSSGSIAL
GRTVLGLPPGVLRLEESQGAASVGQITLARHWAEALGHHGIVAGQILVTPQDTEERRRYL
NARATVLKLLEMRAVPVVNENDTVATSEIRYGDNDRLAARVATMIDADVLVLFSDIDGLY
TAPPKSDPDARHLAVVERITPEIEAMAGGPASELSRGGMRTKVEAAKIAASGGTHLVIAD
GRGKNPLKAVRDGARCTWFLSGSTPTAARKTWIAGSLEPRGTLTIDAGAEQALRSGASLL
PVGVRAIEGSFSRGDAVMIRDPEGRILGRGLVAYDSAEAALIIGHPSARIPELLNYPGRA
WMVHRDDLALF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgatccctgccctcgaagaatttcgccgtgtggtcatcaaggtcggctcggccctgctg
gtcgaccgcagtgccggccgcctgcgccatgcctggctcgcggcgctggccgaggacatc
gcggagttgcacgggcgcggcgtcgacgttctggtcgtgtcgtccggcagcatcgccctc
ggccggacggtgctgggtttgccgcccggcgtcctgcgcctggaggagagccagggcgcg
gcctcggtggggcagatcacgctggcgcgccactgggccgaagctctgggccatcacggc
atcgtcgcaggccagatcctcgtgacgccgcaggacaccgaggagcgccgccgctacctc
aacgcccgcgccaccgtgctgaagctcctggagatgcgcgcggtcccggtcgtgaacgag
aacgacacggtggcgacctcggagatccgctacggcgacaacgaccggctcgccgcccgg
gtcgccaccatgatcgacgccgacgtgctggtgctgttctcggacatcgacggcctctac
accgcgccgcccaagagcgatccggacgcccgccacctcgccgtggtcgagcgcatcacc
ccggagatcgaggcgatggccggcggcccggcctccgagctgtcgcggggcggcatgcgc
accaaggtcgaggccgccaagatcgccgcctcgggcggcacgcacctggtcatcgcggac
ggacgcgggaagaacccgctcaaggccgtgcgggacggcgcgcgctgcacgtggttcctg
tcgggctccacgccgacggccgcccggaagacctggatcgccggctccctcgagccacgc
ggcacgctgacgatcgacgcgggtgccgagcaggcgctccggagcggggccagcctgctc
ccggtgggcgtgcgggcgatcgagggcagcttctcgcgcggcgacgccgtgatgatccgc
gatccggagggccggatcctgggccgcggcctggtggcgtacgacagcgccgaggccgcg
ctgatcatcggtcatccgagcgcgcgcattccggaactgctcaactatcccggtcgcgcc
tggatggtgcaccgcgatgacttggcattgttctag

DBGET integrated database retrieval system