KEGG   Methylobacterium radiotolerans: Mrad2831_0273Help
Entry
Mrad2831_0273     CDS       T00674                                 

Definition
(GenBank) Cellulase
  KO
K20542  endoglucanase [EC:3.2.1.4]
Organism
mrd  Methylobacterium radiotolerans
Brite
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mrad2831_0273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_8 DUF1180
Motif
Other DBs
NCBI-ProteinID: ACB22299
UniProt: B1LS51
Position
complement(290486..291640)
Genome map
AA seq 384 aa AA seqDB search
MSRRDRAPLAAAFLVAAMLPAAAASTQDEPAVPPSTAQPGTQPAQTARAASPGLAGKLGN
DAAWRAYRSRFITDQGRVVDTANGLISHSEGQGYGMLLAVAAGDRVSFERIWGWTRANLM
VRGDELLAWRWSPDKRPAVSDMNNATDGDILVAWALTEAAEAWNEPSYRTAARRIAIEFG
RKTILFRDPHGALLLPAVSGFSARERPDGPLVNLSYWIFPAFPRLALVAPEYDWAALTRS
GLSLLRQSRFGPSNLPTEWISAKDAPHPATGFPPLFSYNAIRVPLYLAWAGLVRPDDLAP
FQALWSSSDRERLPIVDTGDGRKVEWLTEAGYMGIPALVACALDGTPFPEDARGDIGNQN
YYPATLSLLALTAARMRYPSCLKS
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccgcgaccgcgcccctctcgccgcggccttcctcgtcgcggcgatgctgccc
gcggcggcggcctcgacgcaggacgagcctgccgtgccaccgagtaccgcgcaaccgggc
acgcagcccgctcaaaccgccagggcggcgagccccggcctcgccggcaagctcggcaat
gacgccgcatggcgcgcctaccgctcccggttcatcaccgatcagggtcgcgtggtggac
accgccaacggtctgatcagccacagcgagggccagggctacggcatgctgctcgccgtg
gcggcgggcgaccgggtcagcttcgagcggatctggggctggacccgcgccaacctgatg
gtccgcggcgacgaattgctggcgtggcgctggtcgcccgacaagcggccggcggtgagc
gacatgaacaacgccaccgacggggacatcctcgtcgcctgggccctcaccgaggcggcc
gaggcctggaacgagccgagctaccgcaccgcggcccgtcggatcgccatcgagttcggg
cgcaagaccatcctgttccgtgacccgcacggggcgctgctgctccccgcggtctcgggc
ttctcggcccgcgagcgcccggacggcccgctggtcaacctctcctactggatcttcccg
gccttcccgcgcctcgccctggtggcgccggaatacgactgggcggccctgacgcgcagc
ggcctctccctgctgcggcagtcccgcttcggtccgagcaacctgcccaccgagtggatc
tccgccaaggacgctccgcaccccgcaaccggcttcccgcccctgttctcctacaacgcc
atccgcgtcccgctctatctcgcctgggctgggctggtgcggcccgacgacctcgcgccg
ttccaggccctgtggtcgagttctgaccgggagcggctgccgatcgtcgacaccggcgac
gggcggaaggtcgagtggctcaccgaggccggctacatggggatccccgccctggtggcc
tgcgccctcgacggcacgccctttccggaggatgcccggggcgacatcggcaaccagaac
tattatccggcgaccctgagcctcctcgccctgaccgcggcccgcatgcgctacccgtca
tgcctgaagtcctga

DBGET integrated database retrieval system