KEGG   Methylobacterium radiotolerans: Mrad2831_0504Help
Entry
Mrad2831_0504     CDS       T00674                                 

Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mrad2831_0504
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mrd01007]
    Mrad2831_0504
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mrd03016]
    Mrad2831_0504
   03029 Mitochondrial biogenesis [BR:mrd03029]
    Mrad2831_0504
Enzymes [BR:mrd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     Mrad2831_0504
Amino acid related enzymes [BR:mrd01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   Mrad2831_0504
Transfer RNA biogenesis [BR:mrd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Mrad2831_0504
 Prokaryotic type
   Other AARSs
    Mrad2831_0504
Mitochondrial biogenesis [BR:mrd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Mrad2831_0504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon GAD
Motif
Other DBs
NCBI-ProteinID: ACB22515
UniProt: B1LUD5
Position
complement(541796..543673)
Genome map
AA seq 625 aa AA seqDB search
MVPAFPQKKPVMHRYRSHTCGALRPSDVGQSVRLSGWCHRIRDHGGVLFVDLRDHYGLTQ
CVIDSDSPAFKAAETVRSEWVVRIDGRVRTRPAGTENAELPTGAVEVYIDDLEVLGPAGE
LPLPVFGDLEYPEETRLRYRFLDLRREKLHANIMKRGAIIDSLRRRMREGGFFEFQTPIL
TASSPEGARDYLVPSRVHPGKFYALPQAPQQFKQLTMIAGFDRYFQIAPCFRDEDARADR
SPGEFYQLDIEMSFVTQEDVFQAVEPVLRGVFEEFAEGKRVTKEFPRITYADSMLKYGVD
KPDLRNPLIIADVTDLFAREDVAFKAFKGVIASGGVVRAIPATGAAAQSRSFFDKLNDWA
RSEGAPGLGYVVFEEENGQLTGKGPIAKFIPAEVQALIAERAGAKAGDAVFFSAGAEGKA
AGLAGKARIRIGDELGLCDKDQYAFCWITDFPMYEWSEEEKRIDFSHNPFSMPNIDREAF
LALDLDALSSEDENGANTKRILDIKAFQYDIVCNGVELSSGAIRNHRPDVMEKAFAIAGY
GHEVLEQKFGGMLNALRMGAPPHGGIAPGVDRIVMLLCNEPNIREVVLFPMNQRAEDLMM
GAPSEATPKQLRELHIRLNLPEKKA
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atggtgccggccttcccacagaagaagcccgtcatgcaccgttaccgttcccacacctgc
ggggcgctccgcccgtccgacgtcgggcagagtgtccgcctctccggctggtgccaccgc
atccgcgaccacgggggcgtgctgttcgtggatctgcgggaccattacggcctgacgcag
tgcgtgatcgattccgattccccggccttcaaggccgccgagaccgtccgctcggaatgg
gtcgtgcggatcgacggccgcgtccgcacgcgaccggccggtaccgagaatgccgagctg
ccgaccggcgcggtcgaggtctacatcgacgacctcgaggtgctgggtccggccggcgag
ctgccgctgccggtcttcggcgacctcgagtacccggaggagacgcggctccggtaccgc
ttcctcgacctgcgccgggagaagctgcacgccaacatcatgaagcgcggcgcgatcatc
gactcgctccgccgccggatgcgcgagggcggcttcttcgagttccagacgccgatcctg
accgcgtcgagcccggaaggcgcgcgcgactacctcgtgccgtcgcgggtccatcccggc
aagttctacgcgctcccgcaggcgccgcagcagttcaagcagctgacgatgatcgcgggc
ttcgaccgctacttccagatcgcgccctgcttccgcgacgaggatgcccgcgccgaccgc
tcgccgggcgagttctaccagctcgacatcgagatgagcttcgtcacccaggaggacgtg
ttccaggcggtcgagccggtcctgcgcggcgtgttcgaggagttcgccgagggcaagcgc
gtcaccaaggaattcccgcggatcacctacgcggactcgatgctgaagtacggcgtcgac
aagccggacctgcgcaatccgctgatcatcgccgacgtcaccgacctgttcgcccgcgag
gacgtggccttcaaggcgttcaagggcgtgatcgcttccggcggtgtggtccgggcgatc
ccggcgaccggtgcggcggcgcagtcgcgctcgttcttcgacaagctcaacgactgggcc
cgttcggagggcgcgccggggctcggctatgtcgtgttcgaggaggagaacgggcagctc
accggcaaggggccgatcgccaagttcatcccggccgaggtccaggcgctgatcgccgag
cgggccggtgccaaggcgggcgacgcggtgttcttctcggccggcgccgagggcaaggcg
gccggcctcgccggcaaggcgcgcatccgcatcggcgacgagctaggcctctgcgacaag
gaccagtacgccttctgctggatcaccgacttcccgatgtacgagtggagcgaggaagag
aagcggatcgacttctcccacaacccgttctcgatgccgaacatcgaccgcgaggcgttc
ctggcgctcgacctcgacgcgctctccagcgaggacgagaacggcgcgaacaccaagcgg
atcctggacatcaaggcgttccagtacgacatcgtctgcaacggcgtggagctgtcgtcg
ggcgcgatccgcaaccaccgtccggacgtgatggagaaggccttcgcgatcgccggctac
ggccacgaggtcctggagcagaagttcggcggcatgctgaacgccctgcgcatgggcgct
ccgccgcacggcggcatcgcgccgggtgtggaccgcatcgtcatgctcctgtgcaacgag
ccgaacatccgcgaggtggtgctgttcccgatgaaccagcgcgccgaggacctgatgatg
ggcgcgccctccgaggcgacgcccaagcagctgcgcgagctgcacatccggctcaacctg
cccgagaagaaggcctga

DBGET integrated database retrieval system