KEGG   Methylobacterium radiotolerans: Mrad2831_1059Help
Entry
Mrad2831_1059     CDS       T00674                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00071  Fatty acid degradation
mrd00072  Synthesis and degradation of ketone bodies
mrd00280  Valine, leucine and isoleucine degradation
mrd00310  Lysine degradation
mrd00362  Benzoate degradation
mrd00380  Tryptophan metabolism
mrd00620  Pyruvate metabolism
mrd00630  Glyoxylate and dicarboxylate metabolism
mrd00640  Propanoate metabolism
mrd00650  Butanoate metabolism
mrd00900  Terpenoid backbone biosynthesis
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01130  Biosynthesis of antibiotics
mrd01200  Carbon metabolism
mrd01212  Fatty acid metabolism
mrd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mrad2831_1059
   00630 Glyoxylate and dicarboxylate metabolism
    Mrad2831_1059
   00640 Propanoate metabolism
    Mrad2831_1059
   00650 Butanoate metabolism
    Mrad2831_1059
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mrad2831_1059
   00072 Synthesis and degradation of ketone bodies
    Mrad2831_1059
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mrad2831_1059
   00310 Lysine degradation
    Mrad2831_1059
   00380 Tryptophan metabolism
    Mrad2831_1059
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mrad2831_1059
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mrad2831_1059
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mrad2831_1059
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mrd04147]
    Mrad2831_1059
Enzymes [BR:mrd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mrad2831_1059
Exosome [BR:mrd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mrad2831_1059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ACB23068
UniProt: B1M0U8
Position
1116822..1118006
Genome map
AA seq 394 aa AA seqDB search
MTDAVIVATARTPIGKAHRGALNLTRGADLAAHAIRGALDRARLEPEAVEEVVLGCGYPE
NATGGNVARHAALVAGIPVESAGVTVSRFCASGLEAIASAARRIVLDGVPVAVAGGVESI
SLVQPKVQRELTRNAWLEAHLPAIYMPMIETADIVAERYGISREAQDQFALESQRRTAEA
QARGLFDDEIVPMSAVMAVTDKATGETREVETRLAKDEGNRPDTTLEGLAKLKPVRGEGA
FITAGNASQLSDGASASVLMSADEAARRGLTPLGTFRGFASAGCGPDEMGIGPVFAVPRL
LERQGLRVSDIDLWELNEAFASQSVYCRDRLGIDPSRVNVNGGAIAVGHPFGMSGARLVG
HALLEGRRRGARYAVVTMCVAGGQGCAGLFEIGG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcggtgatcgtcgcgaccgcccgtacgcccatcggcaaggcccatcgcggc
gccctgaacctcacccgcggcgccgacctcgccgcccacgcgatccgtggcgccctggac
cgggcgcgcctggaacccgaggcggtcgaggaggtggtgctcggctgcggctatccggag
aacgccacgggcggcaacgtcgcccgccacgcggccctggtcgcggggatcccggtcgag
tcggccggcgtcacggtctcgcgcttctgcgcctcggggctggaggcgatcgccagcgcg
gcccggcggatcgtcctcgacggcgtgccggtggcggtggcgggcggcgtcgagtcgatc
agcctcgtccagccgaaggtccagcgggagctgacccgcaacgcgtggctggaggcccac
ctgccggcgatctacatgccgatgatcgagaccgccgacatcgtggcggaacgctacggc
atctcccgggaggcgcaggaccaattcgcactggagagccagcgccgcacggccgaggcc
caggcgcgcggcctcttcgacgacgagatcgtcccgatgagcgccgtgatggcggtgacc
gacaaggccaccggcgagacccgggaggtcgagacccggctcgccaaggacgagggtaac
cggccggacaccaccctcgaagggctcgcgaagctcaaacccgtgcgcggggagggggcc
ttcatcacggcgggcaatgccagccagctctcggacggagcctcggccagcgtgctgatg
tcggccgacgaggcggcgcggcggggcctgacgccgctcggcaccttccggggcttcgcc
tcggcgggctgcggcccggacgagatgggcatcggcccggtcttcgcggtgccgcggctc
ctggagcggcagggcctgcgcgtctccgacatcgacctgtgggagctgaacgaggccttc
gcgtcccagtcggtctactgccgcgacaggctcgggatcgacccttcgagggtcaacgtc
aacggcggcgccatcgcggtcggccacccgttcggcatgtcgggggcccgactcgtgggc
cacgcgctgctggagggccgccgccgcggcgcgcgctacgccgtggtgaccatgtgcgtc
gccggcggccagggctgcgccggcctgttcgagatcggaggctga

DBGET integrated database retrieval system