KEGG   Methylobacterium radiotolerans: Mrad2831_1717Help
Entry
Mrad2831_1717     CDS       T00674                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00620  Pyruvate metabolism
mrd00630  Glyoxylate and dicarboxylate metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mrad2831_1717
   00630 Glyoxylate and dicarboxylate metabolism
    Mrad2831_1717
Enzymes [BR:mrd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Mrad2831_1717
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACB23712
UniProt: B1M7I7
Position
complement(1825170..1827332)
Genome map
AA seq 720 aa AA seqDB search
MSNLVVAEDLRTFLSEEALPGTGLSADQFWSGFAAIVRDLAPHNRALLDRRDGLQADIDS
WHRDHRGEPHDPVAYAAYLTRIGYLQPEPAAVRVTTENVDAEIAAIAGPQLVVPISNARY
ALNAANARWGSLYDALYGTDAIPQDGDRAPGTGFNPARGAAVVARTKAFLDAIAPLSVGS
WADAVGFSVTDGRLAIDLGAGRSAGLTGSATFAGFTGDAAAPTALLLRHNGLHIEIVIDR
ASPIGRTDPAGIADVVLEAALSTIMDMEDSVAAVDSADKVAVYRSWLGLMRGDLVATLSK
GGRTIERRLAADRTFTAPDGGRLTLPGRSLMLVRHVGHHMYTDAVTLDGAEIPETILDAA
VTALIALHDLKGTGPLRNSRTGSVYMVKPKLHGPDEVAFAVELFGRVEALVGLAPRTLKI
GVMDEERRTTLNLKAAIAAAADRLFFINTGFLDRTGDEIHTSLEAGPVVRKDAMKATAWI
KAYEDGNVDAGLACGLPGHAQIGKGMWAAPDRMAAMLDAKGAHPEAGANTAWVPSPTAAT
LHALHYHQVDVRARQAALAGRAPATRAAMLTLPLAAGALAPEAVREELDNNCQGILGYVV
RWVDQGVGCSKVPDIHEVGLMEDRATLRISSQHIANWLRHGIVDRAQVAAALRRMAETVD
RQNAGDPAYRPMAPGFDGPAFRAAEALVFEGAGQPNGYTEFVLHRFRREAKRLDAPVRAA
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctcgtcgtcgccgaggatctccgcaccttcctgtccgaggaggcgctgccg
gggaccggcctctcggccgaccagttctggtcgggcttcgccgcgatcgtccgcgatctc
gcaccgcacaacagggcgctgctcgaccggcgggacggcctccaggcggacatcgattcc
tggcaccgcgaccatcgcggcgagccgcacgacccggtggcctacgcggcctacctgacg
cggatcggctacctgcagccggagcccgcggccgtgcgggtgaccaccgagaacgtggac
gcggagatcgccgcgatcgccgggccgcagctcgtggtgccgatctccaacgcccgctac
gcgctcaacgccgccaatgcccgctggggcagcctctacgacgccctctacggcaccgac
gcgatcccgcaggacggcgaccgcgcgcccggcaccgggttcaacccggcccggggcgcc
gcggtggtggcccggaccaaggcgttcctcgacgcgatcgcgccgctcagcgtcggctcc
tgggcggatgccgtgggcttctcggtgacggacggccgcctcgccatcgacctcggcgcc
ggccgcagcgccggcctgaccggctcggccaccttcgcgggcttcaccggcgacgccgcg
gcgccgaccgcgctcctgctgcgccacaacggcctgcatatcgagatcgtcatcgaccgc
gcgagcccgatcggacgcaccgacccggccggcatcgccgacgtggtgctggaggccgcc
ctctcgaccatcatggacatggaggattcggtggcggccgtggactcggccgacaaggtc
gcggtctaccggagctggctcggcctgatgcgcggcgacctcgtcgccaccctgtccaag
ggcggccgcacgatcgagcggcggctcgccgcggaccggaccttcacggcccccgacggc
gggcgcctgaccctgccgggccggtcgctgatgctggtccggcatgtcggccaccacatg
tacaccgacgcggtgaccctcgacggcgccgaaattcccgagacgatcctcgacgcggcg
gtcaccgcgctgatcgccctgcacgacctgaagggcaccggtccgctccgcaacagccgg
accggctcggtctacatggtcaagcccaagctgcacggccccgacgaggtcgccttcgcg
gtcgagctgttcggccgggtcgaggcactggtcggactcgcgccgcggacgctcaagatc
ggcgtcatggacgaggagcggcgcacgacgctgaacctcaaggcggcgatcgcggcggcg
gcggaccggctgttcttcatcaacacgggcttcctcgaccggaccggcgacgagatccac
acctcgctggaggccggccccgtggtccgcaaggacgccatgaaggcgaccgcctggatc
aaggcctacgaggacggcaacgtcgatgccggcctcgcctgcggcctgccgggccacgcc
cagatcggcaagggcatgtgggccgcccccgaccggatggccgcgatgctcgacgccaag
ggcgcccacccggaggcgggcgccaacaccgcctgggtgccgtcgccgacggccgcgacg
ctccacgcgctccactaccatcaggtggatgtccgcgcccgccaggcggcgctcgccggc
cgggcgcccgcgacccgcgccgccatgctgaccctgccgctcgccgcgggcgcgctcgcg
ccggaggcggtgcgggaggagctcgacaacaactgccagggaatcctgggctacgtggtc
cgctgggtcgaccagggcgtcggctgctccaaggtgccggacatccacgaggtcgggctg
atggaggaccgcgccaccctgcggatctccagccagcacatcgccaactggctgcgccac
gggatcgtggatcgcgcgcaggtcgccgccgccctgcggcggatggccgaaaccgtcgat
cgccagaacgccggcgacccggcctaccggccgatggccccgggcttcgacgggccggcc
ttccgcgccgccgaggccctggtcttcgagggcgccggccagccgaacggctacaccgag
ttcgtgctgcaccggttccgccgggaggcgaagcgcctggacgcccccgttcgggcggcc
tga

DBGET integrated database retrieval system