KEGG   Methylobacterium radiotolerans: Mrad2831_3720Help
Entry
Mrad2831_3720     CDS       T00674                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00230  Purine metabolism
mrd01100  Metabolic pathways
Module
mrd_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mrad2831_3720
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mrad2831_3720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 TsaE AAA_30 AAA_22 AAA ABC_tran CPT CbiA cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACB25695
UniProt: B1LWZ0
Position
3958573..3959235
Genome map
AA seq 220 aa AA seqDB search
MTEAAGNVSDSIARRGLILILSSPSGAGKTTLTRAIAQDPSWALDLSISVTTRGRRPSEI
DGRHYHFIDREAFDDLRNRDDLLEWAEVHGNFYGTPRRPVEKVLGSGRDMIFDIDYQGTR
QVRSKLAQDVVTVFILPPSMAELRQRLERRAEDSAETIEKRLANARTEIQRWVEYDYVIV
NDDLQNAFRALQGILAAERLRRARRTGLAPFVEGLLAETP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaggcggccgggaacgtctccgactcgatcgcgcggcgcgggttgatcctgatc
ctctcctcgccctccggggcggggaagaccaccctgacgcgggcgatcgcgcaggatccg
agctgggcgctcgacctgtcgatctcggtgaccacgcgggggcggcggccctcggagatc
gacgggcggcactaccacttcattgatcgcgaggcgttcgacgacctgcgcaaccgcgac
gacctgctcgaatgggccgaggtccacggcaacttctacggcacgccccggcggccggtg
gagaaggtgctcggctccggccgggacatgatcttcgacatcgactaccagggcacgcgg
caggttcgctccaagctcgcccaggacgtggtgacggtcttcatcctgccgcccagcatg
gccgagctgcgccagcgcctggagcgccgggcggaggattccgccgagacgatcgagaag
cgtctcgccaacgcccggacggagatccagcgctgggtcgagtacgactacgtcatcgtc
aacgacgacctgcagaacgccttccgggccctccaggggatcctggcggccgagcgtctc
cggcgggcgcgccgcaccggactcgcccccttcgtcgagggcctgctggccgagacgccg
tga

DBGET integrated database retrieval system