KEGG   Methylobacterium radiotolerans: Mrad2831_3923Help
Entry
Mrad2831_3923     CDS       T00674                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00240  Pyrimidine metabolism
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mrad2831_3923
Enzymes [BR:mrd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mrad2831_3923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C
Motif
Other DBs
NCBI-ProteinID: ACB25897
UniProt: B1LZ55
Position
complement(4173658..4174986)
Genome map
AA seq 442 aa AA seqDB search
MPLPQERLPQERLPQETIRAKRDGQPLEPEAIDAFIRGLTDGTVGEGQAAAFAMAVFFRG
LSLPERVALTRAMAESGRVLAWDLPGPVLDKHSTGGIGDAVSLPLAPMVAACGGYVPMIS
GRGLGHTGGTLDKLGSIPGYDATPGLDAFRRVVGTVGCAIIGQTAELAPADRRLYAIRDV
TGTVESRDLITASILSKKLAAGLDGLVMDVKQGSGAFMATLPEARALAGSIVTVAEGAGL
HTAALITDMDAPLASAAGNAVEVAYAIDYLTGARREPRFHAVTVALGAEMLVVGGLAPDR
DSAAERLERALASGRAAEGFGRMVAALGGPGDLLERPAAHLPAAPVRRAVRQDGTVAGIA
TRALGLAVIGLGGGRTRPEDPVDPRVGFTDLAGPGSSGGLLGIVHAADEAAADRAEAALR
AAYRMGDAPTERPPVLERVDAG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgccgcttccccaggagaggcttccccaggagaggctgccccaggagacgatccgggcc
aagcgcgacggccagcccctcgagccggaggcgatcgacgccttcatccgcggcctcacc
gacggcacggtcggggagggtcaggcggcggccttcgccatggcggtgttcttccgcggc
ctgtcgctgccggagcgggtggcgctgacccgggccatggccgagtcgggccgggtcctc
gcctgggacctgcccgggcccgtcctcgacaagcactccaccggcggcatcggcgacgcg
gtgagcctgccgctcgccccgatggtcgcggcctgcggcggctacgtgccgatgatctcg
gggcgcggcctcggccataccggcgggacgctggacaagctcggcagcatcccgggctac
gacgcgacgccgggcctcgacgcgttccgccgggtcgtcggcacggtcggctgcgccatc
atcggccagactgccgagctcgcgcccgcggaccggcgcctctacgcgatccgcgacgtc
accggcacggtcgagtcccgcgacctgatcaccgcctcgatcctgtcgaagaagctcgcc
gccgggctggacgggctcgtgatggacgtgaagcagggctccggcgccttcatggcaacg
ctgcccgaggcgcgcgccctggcggggagcatcgtcacggtggcggagggggccggcctg
cacaccgccgcgctgatcaccgacatggacgcgccgctcgccagcgcggccggcaacgcc
gtcgaggtcgcctacgcgatcgactacctgacgggcgcgcgccgcgagccgcgcttccac
gcggtcacggtggccctgggcgcggagatgctggtcgtcggcggcctcgcgccggaccgc
gacagcgccgcggagcggctggagcgggccctcgcgtcgggccgggcggccgagggcttc
ggccgcatggtcgcggccctgggcgggccgggcgatctcctggagcggccggcggcgcat
ctgccggcggcaccggtgcgccgggcggtgcgtcaggacgggaccgtcgcggggatcgcg
acgcgggcgctgggcctggcggtgatcggactcgggggcggacgcacgcggccggaggat
cccgtcgacccgcgcgtcggcttcacggacctcgccggtccgggatcgtccggcggcctg
ctcgggatcgtccacgcggccgacgaggccgccgcggaccgggccgaggccgcgctgcgg
gcggcctaccggatgggcgacgcgccgacggagcggccgcccgtcctggagcgggtggac
gccggttag

DBGET integrated database retrieval system