KEGG   Methylobacterium radiotolerans: Mrad2831_4017
Entry
Mrad2831_4017     CDS       T00674                                 
Name
(GenBank) Pyridoxal-5'-phosphate-dependent protein beta subunit
  KO
K01738  cysteine synthase [EC:2.5.1.47]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00270  Cysteine and methionine metabolism
mrd00920  Sulfur metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01200  Carbon metabolism
mrd01230  Biosynthesis of amino acids
Module
mrd_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    Mrad2831_4017
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Mrad2831_4017
Enzymes [BR:mrd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.47  cysteine synthase
     Mrad2831_4017
SSDB
Motif
Pfam: PALP ADH_zinc_N
Other DBs
NCBI-ProteinID: ACB25989
UniProt: B1M078
Position
complement(4262266..4263231)
AA seq 321 aa
MRPTSLSPSPSTARIKPSALDLIGHTPLIALDRIHRGPGRILAKAEFMQPGGSVKDRAAR
AIVLAAREDGRLAPGAPVVEMTSGNMGAGLAVACAALGHPLVVTMSAGNSPQRARMLEAL
GAEVILVPQIDGAAGQVTGADVDAAADAAARIAEDRGGYYVNQFHAPECMRAHRETTGPE
IWEQSSGQVDAWVAAVGTGATFLGVAAALRERNPHVICAAVEPEGCRPLAGLSVTKHRHL
IQGTSYGSIPPHWNGDLMDLSIPVTDEEVERWRRGLATQEGLHVGYSAAANVAAAAALLS
SGRLPADAIAVTVLCDTGLKY
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcgccccacatcgctgtccccatctccttcgactgcgcggatcaagccttccgccctc
gacctgatcggccatacgccactgatcgccctcgaccgcatccaccgtggccccggccgc
atcctggcgaaggccgagttcatgcagcccggtgggagcgtcaaggatcgggcggcccgt
gccatcgtccttgccgcgcgtgaggacgggcgtttggcccccggtgcgcccgttgtggag
atgaccagcggcaacatgggagccggtctcgcggtggcctgcgctgcactgggacatccc
ctcgtggtcacgatgtccgccgggaacagcccccagcgtgcccggatgctcgaagcgctc
ggggccgaagttattctggtgccgcagatcgacggagcagctgggcaagtcaccggggcg
gacgtagacgcggcggctgatgcggcggcgcgcatcgcggaagatcggggcggctattac
gtcaaccagttccacgcgccggagtgtatgcgcgcccaccgcgaaacgaccgggccggag
atatgggagcaatcctccggccaggtcgatgcctgggtggccgccgtagggaccggtgcg
actttcctcggagtagcggcggcattgagggaacgtaatccccacgtgatctgcgccgcc
gtcgaaccggagggatgtcgccccctggcgggattatcagtcacaaagcaccgccacctc
atccagggcacaagctacggaagcatccccccacactggaatggtgatctgatggacctg
tctattcccgtaaccgatgaggaggtggagcgctggcgtagagggctcgcgacgcaggag
ggcttgcacgtcggctactcggccgctgccaacgtagctgcggctgctgcgctgttgtcg
tccggacgccttccagccgacgcaatcgccgtgaccgtgctgtgcgatacaggcttgaaa
tactga

DBGET integrated database retrieval system