KEGG   Methylobacterium radiotolerans: Mrad2831_4499Help
Entry
Mrad2831_4499     CDS       T00674                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00361  Chlorocyclohexane and chlorobenzene degradation
mrd00625  Chloroalkane and chloroalkene degradation
mrd01100  Metabolic pathways
mrd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mrad2831_4499
   00361 Chlorocyclohexane and chlorobenzene degradation
    Mrad2831_4499
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     Mrad2831_4499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 HAD Hydrolase_6 Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: ACB26465
UniProt: B1M504
Position
4781198..4781875
Genome map
AA seq 225 aa AA seqDB search
MTDAAKPLAGVKAAVFDAYGTLFDVNAAVQRYAEAVGPDAAHLSEVWRNKQLEYSWTLSL
MGQYAAFWDLTVRALDYALAIHPNVDPGLRERLLDAYRDLEAYPEVPGVLAALRKRGIRT
AVLTNGNAAMVDRAVASAGLADHLDAVLSVDDAQVFKTHPDAYRIALTRLAVGQGDVLFC
SSNRWDVAGARAFGFRTAWVNRKGLPDEYADLAPTVVVESLDGLL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcagcaaaacccctcgcgggcgtgaaggccgcggtgttcgacgcctacggc
acgctgttcgacgtgaatgccgcggtccagcgctacgccgaggcggtggggccggacgcc
gcccacctctccgaggtctggcgcaacaagcagctcgagtacagctggaccctgtcgctg
atgggccagtacgccgccttctgggacctcaccgtgcgggccctcgactatgccctggcg
atccacccgaacgtcgatcccggcctgcgcgagcggctcctcgacgcctaccgcgacctc
gaggcctacccggaggtcccgggcgtgctggcggccctgcgcaagcgcggcatccgcacc
gccgtcctcaccaacggcaacgccgccatggtcgaccgggcggtcgcctcggccgggctc
gccgaccacctcgacgcggtcctctcggtggacgacgcgcaggtgttcaagacccatccc
gacgcctaccggatcgccctgacccggctggcggtggggcagggcgacgtgctgttctgc
tcgtcgaaccgctgggacgtggcgggggcaagggccttcggcttccggaccgcctgggtc
aaccgcaaggggctgcccgacgagtatgccgacctcgcgcccacggtcgtggtcgagtcc
ctcgacgggctgctctga

DBGET integrated database retrieval system