KEGG   Methylobacterium radiotolerans: Mrad2831_5298Help
Entry
Mrad2831_5298     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tom5
Motif
Other DBs
NCBI-ProteinID: ACB27245
UniProt: B1LXC4
Position
5617092..5617277
Genome map
AA seq 61 aa AA seqDB search
MTAADIALLKAEIAFLRAVSPTKGPAPGYSAEELARYDAAASAVLARVSARLYWNTFKRA
A
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcggacatcgctctcctcaaggccgagatcgccttcctccgggcggtgtcc
ccgaccaagggcccggcccccggctactccgccgaagagctcgcccgctacgacgcggcc
gccagcgccgtcctcgcccgggtctcggcccggctctactggaacacgttcaagagggct
gcctga

DBGET integrated database retrieval system