KEGG   Methylobacterium radiotolerans: Mrad2831_5299Help
Entry
Mrad2831_5299     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 HTH_30 HTH_1
Motif
Other DBs
NCBI-ProteinID: ACB27246
UniProt: B1LXC5
Position
5617277..5618227
Genome map
AA seq 316 aa AA seqDB search
MTPVTTEAVVSAYLAAGSFAGAAKSLGMPEATVRFRISKVSGPVREKSSEARFATVQAWA
AERGLLGFKPVLPGFTVKRTTTQYDADGEVSGRFVTQAKAPGAKGAVPAGHVVKGISQLL
DAEGRVTQQWVKTREGRDPIAVSEAIKAAFVGYRTRHKVIPAPAAASADLMMLLPLADWY
IGAHSWGRETGIDWDLRIAEEVIGRAVENVVERSPASGLGVVLGGGDLMHADNQNNRTAK
SGNQLDVDGRYDKVFEVAARMTVRTVDAMLRRHERVLVHILKRNHDHHCSVAIAHHLKAW
YWNEPRVEVHIDPGLF
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgacccccgtcacaaccgaggcggtcgtctccgcctacctcgccgccggttcgttcgca
ggcgccgcgaagtcgctcgggatgccagaggcgaccgtgcggttccggatttccaaggtc
tccggacccgtgcgggaaaagagtagtgaagcccgcttcgctacggttcaggcttgggcg
gccgagcgcgggctgctgggattcaagcccgtcctgccggggttcacagtcaagcggacc
accacccagtacgacgccgacggcgaggtctcgggccggttcgtcacacaggcgaaggca
ccgggcgccaagggcgcggtccccgcgggccatgtcgtgaagggcatcagccaactcctt
gatgccgagggacgcgtcacccagcagtgggtaaagacccgcgagggccgggacccgatc
gccgtctccgaggcgatcaaggcggccttcgtcgggtaccgcacccggcacaaggtcatc
ccggcgccggccgcggcgagcgccgacctgatgatgctgcttcccctcgccgactggtat
atcggggcacatagttggggtcgggagaccggcatcgactgggacctgaggatcgccgag
gaggtcatcgggcgcgccgtcgagaacgtcgtcgagcggtccccggcctccgggctcggc
gtcgtgctgggcggcggcgacttgatgcacgccgacaaccagaacaaccggacggccaag
agcggcaaccaactcgacgtcgacgggcgctacgacaaggtcttcgaggtcgcggcgcgc
atgaccgtccggaccgtcgacgccatgctccgccggcacgagcgcgtcctcgtccacatc
ctcaagcgcaaccacgaccaccactgctcggtcgccatcgcccaccacctgaaggcctgg
tactggaacgaaccccgcgtcgaggtccacatcgacccgggcctgttctga

DBGET integrated database retrieval system