KEGG   Methylobacterium radiotolerans: Mrad2831_5311Help
Entry
Mrad2831_5311     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27258
UniProt: B1LXD7
Position
5624180..5624422
Genome map
AA seq 80 aa AA seqDB search
MADHDHQRYVHASLEHLAASIDTPYEECTCGWKEISDREKAAVRAERLREEKRAAHAAAR
AVIKARRTRDVDLPQVGSFG
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atggccgatcacgaccaccagcggtacgtccacgccagcctggagcacctcgctgcgagc
atagacaccccctacgaggagtgcacctgcggctggaaggagatctcggaccgcgagaag
gcggcggtccgggccgaacggttgcgcgaggagaagcgggcggcccacgccgcggcgcga
gccgtcatcaaggcgcggcgcacccgggatgtcgacctgccgcaggtggggagcttcggc
tga

DBGET integrated database retrieval system