KEGG   Methylobacterium radiotolerans: Mrad2831_5318Help
Entry
Mrad2831_5318     CDS       T00674                                 

Definition
(GenBank) protein of unknown function DUF849
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BKACE
Motif
Other DBs
NCBI-ProteinID: ACB27265
UniProt: B1LXE4
Position
complement(5627030..5627872)
Genome map
AA seq 280 aa AA seqDB search
MAGSRSDAPVVIAVAITGSVPRKKDNPAVPVTVAEQIESTHQAFEAGATLCHIHVRNDDE
SPSSDPDKFAAVQEGLRRHCPGMIVQFSTGGRGRDPAARGLSLRHRPDMASLSTGSVNFP
TIVYENSASLVTDLAGQMKQYGVRPEIEIFDLSHLHGAKRLVEAGLIDARPHVQFVMGVQ
NAMPAEEHLLDILLAETRRILPEATWTAAGIGRNQAIVMDWALARGADAVRTGLEDNIRV
TKDRLAAGNAELVGLAAEAVARHGRRVATPAEARAALGLG
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatcccggagcgacgcacccgtggtgatcgcggtggcgatcaccggctcggtg
ccgcgcaagaaggacaacccggccgttccggtcaccgtggccgagcagatcgagtcgacc
catcaggcgttcgaggcgggcgccacgctctgccacatccacgtgcgcaacgacgacgag
tcgccctcctccgacccggacaagttcgccgccgtgcaggaggggctgcgccggcactgc
ccggggatgatcgtgcagttctcgaccggcgggcgcgggcgcgacccggccgcccgcggc
ctctcgctcaggcaccggcccgacatggcctccctgtccaccggctcggtcaacttcccg
acgatcgtctacgagaattcggcgagcctcgtgaccgacctcgccggccagatgaagcag
tacggcgtccggcccgagatcgagatcttcgacctctcgcacctgcacggggccaagcgc
ctcgtggaggcgggcctgatcgacgcgcgcccgcacgtgcagttcgtgatgggcgtccag
aacgcgatgccggccgaggagcacctcctcgacatcctgctcgccgagacccgccggatc
ctgccggaggcgacctggacggcggccgggatcggccgcaaccaggcgatcgtgatggac
tgggcgctcgcccgcggcgccgacgcggtccgcaccggcctggaggacaacatccgggtg
acgaaggaccgtctggcggccggcaacgccgagctcgtcggcctcgccgccgaggcggtg
gcccgccacggtcgccgcgtcgccacgcccgcggaggcccgcgccgccctgggcctgggc
tga

DBGET integrated database retrieval system