KEGG   Methylobacterium radiotolerans: Mrad2831_5319Help
Entry
Mrad2831_5319     CDS       T00674                                 

Definition
(GenBank) 3-dehydroquinate dehydratase
  KO
K03786  3-dehydroquinate dehydratase II [EC:4.2.1.10]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01130  Biosynthesis of antibiotics
mrd01230  Biosynthesis of amino acids
Module
mrd_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mrad2831_5319
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.10  3-dehydroquinate dehydratase
     Mrad2831_5319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHquinase_II
Motif
Other DBs
NCBI-ProteinID: ACB27266
UniProt: B1LXE5
Position
5628080..5628529
Genome map
AA seq 149 aa AA seqDB search
MNDTVLVLNGPNLNLLGKRQPEIYGRETLADVEALCRETAAGFGLAVDFRQSNAEHALID
AIHEFRVGSAGIVINAGAYTHTSVALLDALNTCEVPVIECHISNVHRREAFRHHSYISLA
ATSVLAGFGTHGYALAIRHLAHLRAGRPA
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacaccgtcctggtcctgaacgggccgaacctgaacctgctcggcaagcgccag
ccggagatctacggccgcgagaccctggccgacgtcgaggccctgtgccgcgagaccgcc
gcgggcttcggcctcgcggtcgatttccggcagagcaacgccgagcacgcgctgatcgac
gcgatccacgaatttcgggtcggctcggccgggatcgtcatcaacgcgggcgcctacacg
cacacctcggtggcgctcctcgacgcgctgaacacctgcgaggtgccggtgatcgagtgc
cacatctcgaacgtccaccggcgcgaggctttccgccaccactcctacatctccctcgcg
gccacgtccgtgctggcggggttcggcacgcacggctacgccctggcgatccggcacctc
gcgcatctgcgggccggcagacctgcttga

DBGET integrated database retrieval system