KEGG   Methylobacterium radiotolerans: Mrad2831_5324Help
Entry
Mrad2831_5324     CDS       T00674                                 

Definition
(GenBank) acetolactate synthase, small subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00290  Valine, leucine and isoleucine biosynthesis
mrd00650  Butanoate metabolism
mrd00660  C5-Branched dibasic acid metabolism
mrd00770  Pantothenate and CoA biosynthesis
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01130  Biosynthesis of antibiotics
mrd01210  2-Oxocarboxylic acid metabolism
mrd01230  Biosynthesis of amino acids
Module
mrd_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mrd_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Mrad2831_5324
   00660 C5-Branched dibasic acid metabolism
    Mrad2831_5324
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Mrad2831_5324
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mrad2831_5324
Enzymes [BR:mrd01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     Mrad2831_5324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4
Motif
Other DBs
NCBI-ProteinID: ACB27271
UniProt: B1LXF0
Position
5634402..5634944
Genome map
AA seq 180 aa AA seqDB search
MNAMNTHYPEPVRVEPVNRHTLAVIVDNEPGVLARISGMFSGRGYNIESLTVSETEEARH
ISRITIVTAGTNAVIEQIKAQLDRLVPVHRVVDLTLQGNAIEREICLVKVKGEGEHRSEA
LRLAAAFGAKTLDATLNSFVFELTGATEEIDRFVRLMSVIGLVEICRTGISAMGRGAEPL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgatgaacacccactatcccgagcccgtccgcgtcgagccggtgaaccggcac
acgctcgcggtgatcgtcgacaacgagcccggcgtgctcgcccgcatctccggcatgttc
tccggtcgcggctacaacatcgagagcctgacggtctccgagaccgaggaggcgcgccac
atctcccgcatcaccatcgtgaccgcgggcacgaacgccgtgatcgagcagatcaaggcg
cagctcgaccggctggtgccggtgcaccgggtggtggacctgacgctccagggcaacgcc
atcgagcgcgagatctgcctggtgaaggtgaagggcgagggcgagcaccgcagcgaggcg
cttcggctcgccgccgccttcggcgccaagacgctcgacgccacgctcaactccttcgtg
ttcgaattgaccggcgccaccgaggagatcgaccggttcgtgcgcctgatgagcgtgatc
gggctggtggagatctgccggaccgggatctccgcgatggggcgcggggcggagccgctc
taa

DBGET integrated database retrieval system