KEGG   Methylobacterium radiotolerans: Mrad2831_5327Help
Entry
Mrad2831_5327     CDS       T00674                                 

Definition
(GenBank) ketol-acid reductoisomerase
  KO
K00053  ketol-acid reductoisomerase [EC:1.1.1.86]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00290  Valine, leucine and isoleucine biosynthesis
mrd00770  Pantothenate and CoA biosynthesis
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01130  Biosynthesis of antibiotics
mrd01210  2-Oxocarboxylic acid metabolism
mrd01230  Biosynthesis of amino acids
Module
mrd_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mrd_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Mrad2831_5327
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Mrad2831_5327
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.86  ketol-acid reductoisomerase (NADP+)
     Mrad2831_5327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IlvN IlvC 2-Hacid_dh_C AdoHcyase_NAD F420_oxidored NAD_binding_2 NAD_binding_7 GARS_N Shikimate_DH GFO_IDH_MocA ThiF CoA_binding Oxidored_nitro
Motif
Other DBs
NCBI-ProteinID: ACB27274
UniProt: B1LXF3
Position
5636427..5637446
Genome map
AA seq 339 aa AA seqDB search
MRVYYDRDADLNLIKGKKVAIVGYGSQGHAHALNLRDSGVKDIVIALREGSATAKKAEHE
GFKVLSVAEAAKWADVVMMLTPDELQGDIYRESLEGNMKQGAALLFAHGLNVHFNLIEPR
KDLDVLMVAPKGPGHTVRSEYLRGGGVPTLIAIAQDASGNAHDLGLSYASANGGGRAGII
ETTFKEECETDLFGEQAVLCGGLVELIKAGFETLVEAGYAPEMAYFECLHEVKLIVDLIY
EGGIANMNYSISNTAEYGEYVTGPRIVTPETKAEMKRVLNDIQSGTFTRNWMLENKVNQT
SFKATRAKLAAHPIEEVGAKLRGMMPWISEKALVDKTRN
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgtattacgatcgcgacgccgacctgaacctgatcaagggcaagaaggtcgcc
atcgtcggctacggcagccagggccacgcccacgcgctcaacctgcgcgattccggcgtg
aaggacatcgtcatcgcgctgcgcgagggctccgccaccgccaagaaggccgagcacgag
ggcttcaaggttctctcggtcgccgaggccgccaagtgggccgacgtggtgatgatgctc
acccccgacgagctgcagggcgacatctaccgcgagtccctcgagggcaacatgaagcag
ggcgccgcgctgctgttcgcccacggcctcaacgtccacttcaacctgatcgagccgcgc
aaggatctcgacgtcctgatggtcgccccgaagggcccgggccacaccgtgcgctccgag
tacctccgcggcggcggcgtgccgaccctgatcgccatcgcgcaggacgcctccggcaac
gcccacgatctcggcctgtcgtacgcctcggcgaacggcggcggccgcgccggcatcatc
gagacgaccttcaaggaagagtgcgagaccgacctgttcggcgagcaggccgtgctctgc
ggcggcctcgtcgagctgatcaaggccggcttcgagaccctggtcgaggcgggctacgcc
cccgagatggcctatttcgagtgcctccacgaggtgaagctgatcgtcgacctcatctac
gagggcggcatcgccaacatgaactactcgatctccaacacggccgagtacggcgagtac
gtcaccggcccgcgcatcgtcacgcccgagaccaaggccgagatgaagcgcgtgctgaac
gacatccagtcgggcaccttcacgcgcaactggatgctggagaacaaggtcaaccagacc
tcgttcaaggcgacccgcgcgaagctcgccgcccacccgatcgaggaggtcggcgccaag
ctccgcggcatgatgccgtggatctccgagaaggcgctcgtcgacaagacccgcaactga

DBGET integrated database retrieval system