KEGG   Methylobacterium radiotolerans: Mrad2831_5328Help
Entry
Mrad2831_5328     CDS       T00674                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase-related FMN-binding
  KO
K07006  uncharacterized protein
Organism
mrd  Methylobacterium radiotolerans
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Mrad2831_5328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Putative_PNPOx
Motif
Other DBs
NCBI-ProteinID: ACB27275
UniProt: B1LXF4
Position
5637612..5638265
Genome map
AA seq 217 aa AA seqDB search
MASLYSDAHRALQEEFGTTKLAVRLDEDWVHDSVQPDEAAFIGSRDMFFLSTVDPDGMPT
VSYKGGPTGFVKVLDDKTLVFPGFDGNGMFYSMGNIEGQAKVGLLFIDFETPHRIRVQGH
ASLLRDDALMAEYTEAKYLVRVAVTKIWVNCPRYIHKYKKLEQNKYVPRPDRETPLAAWK
RLDLAGDVISDADKARVAKEGKLEVSEYAALVARGEA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgctctattccgacgcgcaccgggcgctccaggaggagttcggcacgaccaag
ctcgccgtgcgcctcgacgaggactgggttcacgacagcgtccagccggacgaggccgcg
ttcatcggctcccgcgacatgttcttcctgtcgaccgtcgatccggacgggatgcccacc
gtctcctacaagggcggccccacgggcttcgtgaaggtgctcgacgacaagacgctcgtc
ttccccggattcgacggcaacggcatgttctactcgatgggcaatatcgaggggcaggcc
aaggtcggcctgctgttcatcgacttcgagacgccgcaccgcatccgcgtgcaggggcac
gcgtcgctgctgcgcgacgacgccctcatggccgagtataccgaggccaagtacctggtg
agggtcgcggtcaccaagatctgggtcaactgcccgcgctacatccacaagtacaagaag
ctcgagcagaacaagtacgtgccgcggcccgatcgcgagaccccgctcgccgcctggaag
cggctcgacctcgcgggcgacgtgatcagcgacgccgacaaggcccgcgtcgccaaggag
ggcaagctcgaggtctccgagtacgcggcgctggtcgcccgcggcgaggcctga

DBGET integrated database retrieval system