KEGG   Methylobacterium radiotolerans: Mrad2831_5339Help
Entry
Mrad2831_5339     CDS       T00674                                 

Definition
(GenBank) intracellular septation protein A
  KO
K06190  intracellular septation protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IspA Ceramidase
Motif
Other DBs
NCBI-ProteinID: ACB27286
UniProt: B1LYA2
Position
5649690..5650304
Genome map
AA seq 204 aa AA seqDB search
MQIESVPPHRHLPPLVKLALELGPLVLFFLGNAYSEKFGVAPDQKLFVATGVFIAATVVA
LAIHYVMVRRLPIMPLVSGVVVVVFGGLTLALQDKTFIMVKPTIVNALFGTVLLGGLVFG
RSLLSVVLDSMFSLTEEGWRKLTFRWGVFFFVLAALNELVWRTQTEDFWVNFKVFGIMPI
TVLFALAQTPLLTRYERKKAQPEA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgaatccgtccccccgcaccgccacctgccgccgctcgtgaagctggcgctg
gaactcgggccgctggtgctgttcttcctcggcaacgcctattccgagaagttcggcgtc
gctccggaccagaagctgttcgtggccacgggcgtgttcatcgcggcgaccgtggtggca
ctggcgatccactacgtgatggtgcggcgcctgccgatcatgccactcgtgtccggcgtg
gtggtggtggtgttcggcggcctgaccctggcgctgcaggacaagaccttcatcatggtc
aagccgaccatcgtgaacgccctgttcggcaccgtgctgctcggcggcctcgtcttcggg
cgctcgctgctgtcggtggtgctcgactcgatgttcagcctcaccgaggagggctggcgc
aagctcaccttccgctggggcgtgttcttcttcgtgttggccgcgctcaacgagctcgtc
tggcggacccagaccgaggatttctgggtcaacttcaaggtgttcggcatcatgccgatc
accgtgctgttcgccctcgcgcagacgccgctgctcacccgctacgagcgcaagaaggcg
cagccggaggcctga

DBGET integrated database retrieval system