KEGG   Methylobacterium radiotolerans: Mrad2831_5343Help
Entry
Mrad2831_5343     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27290
UniProt: B1LYA6
Position
5652334..5653008
Genome map
AA seq 224 aa AA seqDB search
MRTADKQIADILVRYGEPFGGNVWRVQGTAVIYHKTLERIAAQAGIVFEPPTVIRAERDE
AVILVTGRLPGAKPGTERVEWSMGEALVNVNYRVSGKQAAYVYAMAEKRGKDRVILKLIE
LHGLVYSEEEADEFRAHQVPVRAVDEDFEEAPAFDEVTEAEGDLKRRIDAAETINAVTDL
MLDGATQAVLATMPPGTRDEVRDYAKARLVALGWPKRAGRRSAA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgccgacaagcagatcgccgacatcctcgtccgctacggcgagcccttcggg
ggcaacgtctggcgcgtccaggggaccgccgtcatctatcacaagacgctggagcgcatc
gccgcccaggccggcatcgtcttcgagccgccgaccgtcatccgggccgagcgcgacgag
gccgtgatcctggtgaccggccggctgcccggcgcgaagcccggcaccgagcgggtcgag
tggtccatgggcgaggccctagtcaacgtgaactaccgcgtctcgggcaagcaggcggcc
tacgtctacgccatggccgagaagcgcgggaaggaccgcgtcatcctcaagctcatcgag
ctgcacggcctcgtctactcggaggaggaggccgacgagttccgcgcccaccaggtcccg
gtccgggccgtcgacgaggatttcgaggaggcacccgccttcgacgaggtcaccgaggcc
gagggcgacctcaagcgccgcatcgacgcggccgagacgatcaacgcggtcaccgacctg
atgctggacggcgccacgcaggccgtcctggcgacgatgccgcccggcacccgcgacgag
gtgcgcgactacgccaaggcccgcctcgtggcgctcggctggccgaagcgcgccggacgc
cgcagcgccgcctga

DBGET integrated database retrieval system